Monday 7 August 2017

Trading System Architettura Diagramma


Il LMAX Architettura Nel corso degli ultimi anni abbiamo continuiamo a sentire che il pranzo libero è over1 - non possiamo aspettarci aumenti di velocità della CPU individuale. Quindi, per scrivere codice veloce che dobbiamo utilizzare in modo esplicito più processori con il software concorrente. Questo non è una buona notizia - la scrittura di codice concorrente è molto difficile. Serrature e semafori sono difficili da ragionare su e difficile prova - il che significa che stiamo spendendo più tempo a preoccuparsi di soddisfare il computer che stiamo risolvendo il problema del dominio. Vari modelli di concorrenza, come attori e Software Transactional Memory, hanno lo scopo di rendere questo più facile - ma c'è ancora un peso che introduce bug e complessità. Quindi ero affascinato sentir parlare di una conferenza al QCon Londra nel marzo dello scorso anno da LMAX. LMAX è una nuova piattaforma di trading finanziario retail. La sua innovazione di business è che si tratta di una piattaforma di vendita al dettaglio - che consente a chiunque di commercio in una gamma di products2 finanziari derivati. Una piattaforma di trading come questo ha bisogno di una latenza molto bassa - commerci devono essere elaborati rapidamente perché il mercato si sta muovendo rapidamente. Una piattaforma di vendita al dettaglio aggiunge complessità perché ha a che fare questo per un sacco di gente. Così il risultato è più utenti, con un sacco di mestieri, i quali devono essere elaborati quickly.3 Dato il passaggio al pensiero multi-core, questo tipo di impegnativa prestazioni sarebbe naturalmente suggerire un modello di programmazione in modo esplicito simultaneo - e in effetti questa era la loro punto di partenza. Ma la cosa che ha ottenuto l'attenzione della gente a QCon era che questo non era dove sono finiti. In realtà finirono facendo tutta la logica di business per la loro piattaforma: tutti i mestieri, da tutti i clienti, in tutti i mercati - su un singolo thread. Un filo che elaborerà 6 milioni di ordini al secondo utilizzando hardware.4 merce Elaborazione di un sacco di operazioni con bassa latenza e nessuna delle complessità di codice concorrenti - come posso resistere a scavare in quella Fortunatamente un'altra differenza LMAX ha ad altre società finanziarie è che sono molto felice di parlare delle loro scelte tecnologiche. Così ora LMAX è stato in produzione per un po 'il suo tempo di esplorare il loro design affascinante. Struttura generale Figura 1: Architettura LMAXs in tre macchie A un livello superiore, l'architettura ha perturbatori uscita ingresso distruttore tre parti di business logic processor5 Come suggerisce il nome, il processore logica di business gestisce tutta la logica di business nell'applicazione. Come ho indicato in precedenza, lo fa come un programma a thread singolo java che reagisce alle chiamate di metodo e produce eventi di uscita. Di conseguenza, il suo un semplice programma Java che pretende molto richiede alcuna quadri di piattaforma per l'esecuzione diversa dalla JVM in sé, che gli permette di essere facilmente eseguito in ambienti di test. Anche se il processore Business Logic può essere eseguito in un ambiente semplice per i test, non vi è invece la coreografia più coinvolto per farlo funzionare in un ambiente di produzione. messaggi di input devono essere prese fuori un gateway di rete e eseguito l'unmarshalling, replicato e journal. messaggi in uscita devono essere marshalling per la rete. Questi compiti vengono gestiti dalle distruttori di ingresso e uscita. A differenza del processore business logic, questi sono componenti simultanei, in quanto comportano operazioni di IO che sono sia lenta e indipendenti. Sono stati progettati e costruiti appositamente per LMAX, ma (come l'architettura complessiva) sono applicabili altrove. Business Logic Processor Tenendo tutto in memoria Il processore Business Logic riceve l'input dei messaggi in sequenza (sotto forma di una chiamata di metodo), gestisce la logica di business su di esso, ed emette eventi di uscita. E 'opera interamente in memoria, non esiste un database o altro archivio permanente. Mantenendo tutti i dati in memoria ha due vantaggi importanti. In primo luogo la sua veloce - non c'è nessun database per fornire lento IO per accedere, né vi è alcuna comportamento transazionale per l'esecuzione in quanto tutta la lavorazione avviene in modo sequenziale. Il secondo vantaggio è che semplifica la programmazione - non c'è nessun mappatura objectrelational da fare. Tutto il codice può essere scritto utilizzando modello a oggetti Javas senza dover scendere a compromessi per la mappatura di un database. L'utilizzo di una struttura in memoria ha una conseguenza importante - che cosa succede se tutto si blocca Anche i sistemi più resistenti sono vulnerabili a qualcuno tirare il potere. Il cuore di affrontare questo evento Sourcing - il che significa che lo stato attuale del processore business logic è interamente derivabile elaborando i eventi di input. Finché il flusso di eventi di input è conservato in un negozio durevole (che è uno dei lavori del disgregatore input) è sempre possibile ricreare lo stato corrente del motore logica aziendale riproducendo eventi. Un buon modo per capire questo è quello di pensare ad un sistema di controllo versione. sistemi di controllo versione sono una sequenza di commit, in qualsiasi momento, si può costruire una copia di lavoro per l'applicazione di tali commit. VCS è più complicata di quanto il processore Business Logic perché devono supportare ramificazione, mentre il processore Business Logic è una sequenza semplice. Quindi, in teoria, si può sempre ricostruire lo stato del processore Business Logic rielaborando tutti gli eventi. In pratica, tuttavia, che sarebbe troppo lungo se avete bisogno di far girare uno. Così, proprio come con i sistemi di controllo versione, Lmax può rendere istantanee dello stato del processore Business Logic e il ripristino delle istantanee. Prendono una fotografia ogni sera durante i periodi di bassa attività. Il riavvio del processore Business Logic è veloce, un riavvio completo - compreso il riavvio del JVM, il caricamento di un recente snapshot e la riproduzione di un giorno vale la pena di riviste - richiede meno di un minuto. Istantanee rendono l'avvio di una nuova Processor Business Logic più veloce, ma non abbastanza velocemente dovrebbe un incidente Business Logic Processore alle 2 del pomeriggio. Come risultato LMAX conserva più Business Logic processori in esecuzione tutto il tempo6. Ogni evento ingresso viene elaborato da più processori, ma tutti tranne un processore ha ignorato la sua uscita. Se il processore vivo sicuro, il sistema passa ad un altro. Questa capacità di gestire fail-over è un altro vantaggio di utilizzare Event Sourcing. Con l'evento di sourcing in repliche possono passare tra i processori in una manciata di microsecondi. Oltre a scattare istantanee ogni sera, si riavviano anche business logic Processori ogni notte. La replica consente loro di fare questo senza tempi di inattività, in modo da continuare a elaborare i commerci 247. Per ulteriori background su Sourcing eventi, vedere il progetto di modello sul mio sito da alcuni anni fa. L'articolo è più focalizzato sulla gestione delle relazioni temporali piuttosto che i benefici che utilizzano LMAX, ma lo fa spiegare l'idea di base. Evento Sourcing è prezioso perché permette al processore di funzionare del tutto in memoria, ma ha un notevole vantaggio per la diagnostica. Se qualche comportamento imprevisto si verifica, le copie della squadra sequenza di eventi al loro ambiente di sviluppo e li ripete lì. Questo permette loro di esaminare quanto accaduto molto più facilmente che è possibile nella maggior parte degli ambienti. Questa capacità diagnostica si estende alla diagnostica di business. Ci sono alcune attività aziendali, come ad esempio nella gestione del rischio, che richiedono un calcolo significativo quello non è necessario per l'elaborazione degli ordini. Un esempio è sempre una lista dei primi 20 clienti con profilo di rischio in base alle loro posizioni di trading attuali. Il team gestisce questo facendo girare un modello di dominio replica e per svolgere l'computazione là, dove non interferisce con l'elaborazione degli ordini di base. Questi modelli di dominio analisi possono avere modelli di dati variante, mantenere diversi set di dati in memoria, ed eseguire su macchine diverse. Ottimizzazione delle prestazioni Finora Ive ha spiegato che la chiave per la velocità del processore Business Logic sta facendo tutto in sequenza, in memoria. Solo facendo questo (e niente di veramente stupido) consente agli sviluppatori di scrivere codice in grado di elaborare 10K TPS7. Hanno quindi scoperto che concentrandosi su semplici elementi di buon codice potrebbe portare questo in su nella gamma 100K TPS. Questo ha solo bisogno di codice ben presi e piccoli metodi - in sostanza questo permette Hotspot per fare un lavoro migliore di ottimizzazione e per le CPU di essere più efficiente nella cache il codice come la sua esecuzione. Ci è voluto un po 'più di intelligenza per andare su un altro ordine di grandezza. Ci sono diverse cose che la squadra LMAX trovato utile per arrivarci. Uno era di scrivere implementazioni personalizzate delle collezioni Java che sono stati progettati per essere cache-amichevole e attento con garbage8. Un esempio di questo sta usando anela Java primitivi come chiavi HashMap con una implementazione Mappa gamma sostenuta appositamente scritto (LongToObjectHashMap). In generale theyve trovato che la scelta di strutture di dati spesso fa una grande differenza, maggior parte dei programmatori basta afferrare qualunque Lista hanno usato l'ultima volta, piuttosto che pensare che l'attuazione è quello giusto per questo context.9 Un'altra tecnica per raggiungere quel livello superiore di prestazioni sta mettendo attenzione in test delle prestazioni. Ive ha da tempo notato che la gente parla molto di tecniche per migliorare le prestazioni, ma l'unica cosa che fa davvero la differenza è di provarlo. Anche i buoni programmatori sono molto bravi a costruire argomenti di prestazioni che finiscono per essere sbagliato, quindi i migliori programmatori preferiscono profiler e casi di test per speculation.10 Il team LMAX ha anche scoperto che la scrittura dei test prima è una disciplina molto efficace per test di performance. Modello di programmazione Questo stile di trattamento non introdurre alcuni vincoli nel modo di scrivere e organizzare la logica di business. Il primo di questi è che si deve prendere in giro fuori di ogni interazione con i servizi esterni. Una chiamata servizio esterno sarà lenta, e con un unico filo conduttore si ferma tutta la macchina di elaborazione degli ordini. Di conseguenza non puoi effettuare chiamate verso servizi esterni all'interno della logica di business. Invece è necessario concludere che l'interazione con un evento di uscita, e attendere un altro evento di input per raccogliere su nuovamente. Ill utilizzare un semplice esempio non LMAX per illustrare. Immaginate di fare un ordine per i fagioli di gelatina con carta di credito. Un semplice sistema di vendita al dettaglio avrebbe preso le informazioni sull'ordine, utilizzare un servizio di validazione carta di credito per verificare il numero di carta di credito, e quindi confermare l'ordine - tutto all'interno di una singola operazione. Il filo elaborare l'ordine avrebbe bloccato in attesa che la carta di credito da controllare, ma quel blocco wouldnt essere molto lungo per l'utente e il server può sempre eseguito un altro thread sul processore mentre la sua attesa. Nell'architettura LMAX, si potrebbe dividere l'operazione in due. La prima operazione di catturare le informazioni di ordine e si conclude con l'emissione di un (validazione carta di credito richiesto) evento per la società della carta di credito. Il processore Business Logic avrebbe poi proseguire l'elaborazione degli eventi per gli altri clienti fino a quando non ha ricevuto un evento di credito-card-convalidato nel suo flusso di eventi di input. Di trasformazione di tale evento sarebbe svolgere i compiti di conferma per l'ordine. Lavorando in questo tipo di stile asincrono event-driven, è un po 'insolita - anche se con asincronia per migliorare la reattività di un'applicazione è una tecnica familiare. Inoltre aiuta il processo di business essere più resistente, come si deve essere più esplicito nel pensare a diverse cose che possono accadere con l'applicazione remota. Una seconda caratteristica del modello di programmazione sta nella gestione degli errori. Il modello tradizionale di sessioni e transazioni di database fornisce una capacità di gestione degli errori utile. Se qualcosa dovesse andare storto, è facile buttare via tutto quello che è accaduto finora nella interazione. I dati di sessione è transitorio, e può essere scartato, a costo di una certa irritazione all'utente se nel mezzo di qualcosa di complicato. Se si verifica un errore sul lato database, è possibile eseguire il rollback della transazione. LMAXs in memoria strutture sono persistenti attraverso eventi di input, quindi se c'è un errore la sua importante non lasciare che la memoria in uno stato incoerente. theres Tuttavia nessun impianto automatizzato di rollback. Di conseguenza la squadra LMAX pone molta attenzione nei garantire gli eventi di ingresso sono pienamente validi prima di fare qualsiasi mutazione del stato persistente in memoria. Essi hanno scoperto che il test è uno strumento chiave per stanare questo tipo di problemi prima di andare in produzione. Ingresso e di uscita Disgregatori Anche se la logica di business si verifica in un singolo thread, ci sono un numero di compiti da fare prima di poter invocare un metodo di oggetto di business. L'ingresso originale alla trasformazione si stacca il filo nella forma di un messaggio, il messaggio deve essere deserializzata in una forma adeguata per Processor business logic da utilizzare. Evento Sourcing basa sul mantenere un diario durevole di tutti gli eventi di input, in modo che ogni messaggio di input deve essere imperniato su un negozio durevole. Infine l'architettura si basa su un gruppo di Business Logic processori, quindi dobbiamo replicare i messaggi di input in questo cluster. Allo stesso modo sul lato di uscita, gli eventi di uscita devono essere marshalling per la trasmissione sulla rete. Figura 2: Le attività svolte dal disgregatore di ingresso (utilizzando UML attività diagramma di notazione) Il replicatore e journaler coinvolgono IO e quindi sono relativamente lenti. Dopo tutto l'idea centrale dell'attività Logic Processor è che evita fare qualsiasi IO. Anche questi tre compiti sono relativamente indipendenti, tutti loro devono essere fatto prima che il processore business logic lavora su un messaggio, ma possono fatto in qualsiasi ordine. Quindi, a differenza con il processore Business Logic, dove ogni commercio cambia il mercato delle negoziazioni successive, vi è una scelta naturale per la concorrenza. Per gestire questa concorrenza della squadra LMAX ha sviluppato uno speciale componente della concorrenza, che essi chiamano 11 Disruptor. La squadra LMAX ha rilasciato il codice sorgente per il Disruptor con una licenza open source. A livello greggio si può pensare di un disgregatore come grafico multicast delle code in cui i produttori mettono gli oggetti su di esso che vengono inviati a tutti i consumatori per il consumo parallelo attraverso le code a valle separati. Quando si guarda dentro si vede che questa rete di code è in realtà una singola struttura dati - un buffer circolare. Ogni produttore e consumatore ha un contatore di sequenza per indicare quale slot nel buffer sua attualmente lavorando. Ogni producerconsumer scrive il proprio contatore di sequenza, ma in grado di leggere gli altri sequenziano contatori. In questo modo il produttore in grado di leggere i contatori consumatori per assicurare la fessura si vuole scrivere in è disponibile senza alcun blocco sui banchi. Allo stesso modo un consumatore può garantire elabora solo i messaggi una volta un altro consumatore è fatto con esso guardando i contatori. Figura 3: Coordinate Il disgregatore di ingresso un produttore e quattro consumatori perturbatori uscita sono simili ma hanno solo due consumatori sequenziali per marshalling e output.12 eventi di uscita sono organizzati in diversi argomenti, in modo che i messaggi possono essere inviati solo i ricevitori che sono interessati in loro. Ogni argomento ha il suo distruttore. I perturbatori Ive descritti vengono utilizzati in uno stile con un produttore e più consumatori, ma questo non è una limitazione della progettazione del disgregatore. Il disgregatore può lavorare con più produttori di troppo, in questo caso ancora non ha bisogno locks.13 Un vantaggio del disegno disgregatore è che rende più facile per i consumatori di recuperare rapidamente se si imbattono in un problema e restare indietro. Se il unmarshaler ha un problema durante l'elaborazione sulla fessura 15 e ritorna quando il ricevitore è in fessura 31, è in grado di leggere i dati da slot 16-30 in un unico lotto di recuperare. Questo lotto di leggere i dati dal disgregatore rende più facile per i consumatori in ritardo di sviluppo per recuperare rapidamente, riducendo così la latenza complessiva. Ive ha descritto le cose qui, con uno ciascuno dei journaler, replicatore, e unmarshaler - questo è davvero quello che fa LMAX. Ma il disegno consentirebbe multipli di questi componenti per eseguire. Se è stato eseguito due journalers allora si potrebbe prendere le persino slot e l'altro journaler avrebbe preso gli slot dispari. Ciò consente inoltre la concorrenza di queste operazioni IO questo dovrebbe diventare necessario. I buffer ad anello sono di grandi dimensioni: 20 milioni di slot per buffer di ingresso e 4 milioni di slot per ciascuno dei buffer di uscita. I contatori di sequenza sono interi lunghi 64 bit che aumentano monotono anche se gli slot anello wrap.14 Il buffer è impostata su una dimensione di questo è una potenza di due in modo che il compilatore può fare un'operazione modulo efficiente per mappare dal numero del contatore sequenza per il numero di slot . Come il resto del sistema, i perturbatori sono rimbalzati durante la notte. Questo rimbalzo è fatto principalmente di cancellare la memoria in modo che ci sono meno possibilità di un costoso evento garbage collection durante il commercio. (Penso anche la sua una buona abitudine per riavviare regolarmente, in modo che in sala prove che come farlo per le emergenze.) Il lavoro journalers è quello di memorizzare tutti gli eventi in una forma durevole, in modo che possano essere riprodotti se qualcosa dovesse andare storto. LMAX non utilizza un database per questo, solo il file system. Essi flusso degli eventi sul disco. In termini moderni, i dischi meccanici sono terribilmente lento per l'accesso casuale, ma molto veloce per lo streaming - da cui il disco di tag-line è il nuovo tape.15 In precedenza ho detto che LMAX corre più copie del suo sistema in un cluster per supportare una rapida failover . Il replicatore mantiene questi nodi in sincronia. Tutte le comunicazioni in LMAX utilizza il multicasting IP, così i clienti non hanno bisogno di sapere quale indirizzo IP è il nodo principale. Solo il nodo master ascolta direttamente a eventi di input e gestisce un replicatore. Il replicatore trasmette gli eventi di input ai nodi slave. Se il nodo master scendere, la sua mancanza di battito cardiaco sarà notato, un altro nodo diventa maestro, inizia l'elaborazione di eventi di input, e comincia la sua replicatore. Ogni nodo ha il suo disgregatore di ingresso e, quindi, ha il suo giornale e lo fa proprio unmarshalling. Anche con il multicasting IP, la replica è ancora necessaria perché i messaggi IP possono arrivare in un ordine diverso su diversi nodi. Il nodo master fornisce una sequenza deterministica per il resto del trattamento. Il unmarshaler trasforma i dati degli eventi dal filo in un oggetto Java che può essere utilizzato per richiamare il comportamento sul processore Business Logic. Pertanto, a differenza degli altri consumatori, ha bisogno di modificare i dati nel buffer ad anello in modo da poter memorizzare questo oggetto eseguito l'unmarshalling. La regola è che i consumatori sono permesso di scrivere al buffer circolare, ma ogni campo scrivibile può avere un solo questo è di consumo paralleli permesso di scrivere. Ciò preserva il principio di avere solo un singolo scrittore. 16 Figura 4: L'architettura LMAX con i disgregatori espansi Il disgregatore è un componente di uso generale che può essere utilizzato al di fuori del sistema LMAX. Di solito le società finanziarie sono molto reticente sui loro sistemi, tacere anche su elementi che arent germano per il loro business. Non solo è LMAX stato aperto circa la sua architettura complessiva, hanno open source il codice distruttore - un atto che mi rende molto felice. Non solo sarà questo permetterà ad altre organizzazioni a fare uso del disgregatore, che consentirà anche per ulteriori test delle sue proprietà di concorrenza. Code e la loro mancanza di simpatia meccanico Il LMAX architettura catturato l'attenzione della gente, perché è un modo molto diverso di avvicinarsi un sistema ad alte prestazioni per ciò che molte persone stanno pensando. Finora Ive ha parlato di come funziona, ma havent approfondito troppo in perché è stato sviluppato in questo modo. Questo racconto è interessante in sé, perché sembra proprio questa architettura di poco. Ci è voluto molto tempo di cercare alternative più convenzionali, e rendersi conto dove sono stati viziata, prima che la squadra si stabilirono su questo. La maggior parte dei sistemi di business in questi giorni hanno una architettura di base che si basa su più sessioni attive coordinati attraverso un database transazionale. Il team LMAX erano familiarità con questo approccio, e fiducioso che wouldnt lavorare per LMAX. Questa valutazione è stata fondata nel esperienze di Betfair - capogruppo che ha configurato LMAX. Betfair è un sito di scommesse che permette alle persone di scommettere su eventi sportivi. Gestisce molto elevati volumi di traffico con un sacco di contesa - scommesse sportive tendono a scoppiare intorno a particolari eventi. Per fare questo lavoro hanno uno dei più caldi installazioni di database in tutto e hanno avuto a che fare molti atti innaturali, al fine di farlo funzionare. Sulla base di questa esperienza che sapevano quanto fosse difficile per mantenere le prestazioni Betfairs e erano sicuri che questo tipo di architettura non avrebbe funzionato per la latenza molto bassa che un sito commerciale richiederebbe. Come risultato hanno dovuto trovare un approccio diverso. Il loro approccio iniziale era quello di seguire quello che molti dicono in questi giorni - che per ottenere prestazioni elevate è necessario utilizzare la concorrenza esplicita. Per questo scenario, il che significa consentire ordini da elaborare da più thread in parallelo. Tuttavia, come è spesso il caso con concorrenza, la difficoltà nasce perché questi fili devono comunicare tra loro. L'elaborazione di un ordine cambia le condizioni di mercato e le condizioni devono essere comunicati. L'approccio hanno esplorato nella fase iniziale è stato il modello attore e il suo cugino SEDA. Il modello si basa su attore, oggetti attivi indipendenti con il proprio filo che comunicano tra loro tramite le code. Molte persone trovano questo tipo di modello di concorrenza molto più facile da gestire, rispetto a fare qualcosa sulla base di primitive di blocco. Il team ha costruito un prototipo di scambio utilizzando il modello di attore e ha fatto test di performance su di esso. Che cosa hanno trovato era che i processori trascorso più tempo a gestire le code di fare la vera logica dell'applicazione. accesso coda era un collo di bottiglia. Quando si preme prestazioni come questo, comincia a diventare importante tener conto del modo in cui l'hardware moderno è costruito. La frase di Martin Thompson ama usare è la simpatia meccanico. Il termine deriva dalla macchina da corsa di guida e riflette il conducente, con una sensazione innata per l'auto, in modo che siano in grado di sentire come ottenere il meglio da essa. Molti programmatori, e confesso cado in questo campo, non avete molta simpatia meccanico per come la programmazione interagisce con l'hardware. Che cosa è peggio è che molti programmatori pensano di avere simpatia meccanico, ma la sua costruita su nozioni di come l'hardware utilizzati per il lavoro che ora sono molti anni di data. Uno dei fattori dominanti con CPU moderna che colpisce la latenza, è come la CPU interagisce con la memoria. In questi giorni andando a memoria principale è un'operazione molto lenta in CPU-termini. CPU hanno più livelli di cache, ciascuno dei quali di è significativamente più veloce. Quindi, per aumentare la velocità che si desidera ottenere il vostro codice e dati in quei nascondigli. A un certo livello, il modello attore aiuta qui. Si può pensare a un attore come proprio oggetto che raggruppa codice e dati, che è una unità naturale per la memorizzazione nella cache. Ma gli attori hanno bisogno di comunicare, che lo fanno attraverso le code - e la squadra LMAX osservato che i suoi le code che interferiscono con la cache. La spiegazione viene eseguito in questo modo: al fine di mettere un po 'di dati su una coda, è necessario scrivere a quella coda. Allo stesso modo, a prendere i dati dalla coda, è necessario scrivere alla coda per eseguire la rimozione. Questo è contesa da scrittura - più di un cliente può avere bisogno di scrivere la stessa struttura di dati. Per affrontare la contesa scrivere la coda utilizza spesso serrature. Ma se viene utilizzato un blocco, che può causare un cambio di contesto al kernel. Quando questo accade il processore coinvolti rischia di perdere i dati nelle cache. La conclusione che è venuto a era quello di ottenere il miglior comportamento della cache, è necessario un disegno che ha una sola scrittura di base a qualsiasi location17 memoria. lettori multipli vanno bene, i processori utilizzano spesso speciali collegamenti ad alta velocità tra loro cache. Ma le code falliscono il principio one-scrittore. Questa analisi ha portato la squadra LMAX a un paio di conclusioni. In primo luogo ha portato alla progettazione del disgregatore, che segue con determinazione il vincolo singolo scrittore. In secondo luogo, ha portato alla idea di esplorare l'approccio single-threaded logica di business, porre la domanda di quanto velocemente un singolo thread può andare se liberato di gestione della concorrenza. L'essenza di lavorare su un singolo filo, è per assicurarsi di avere un filo esecuzione su un core, le cache riscaldano, e accesso alla memoria quanto possibile va ai cache piuttosto che alla memoria principale. Ciò significa che sia il codice e il set di lavoro dei dati deve essere il più coerente possibile accedere. mantenendo anche piccoli oggetti con codice e dati insieme permette loro di essere scambiati tra le cache come unità, semplificando la gestione della cache e migliorando ancora le prestazioni. Una parte essenziale del percorso all'architettura LMAX era l'uso di test delle prestazioni. La considerazione e l'abbandono di un approccio attore-based provenivano da costruzione e le prestazioni test di un prototipo. Analogamente molti dei passi nel migliorare le prestazioni dei vari componenti sono stati abilitati dal test di performance. simpatia meccanica è molto prezioso - aiuta a formare ipotesi su quali miglioramenti si possono fare, e vi guida per inoltrare passi piuttosto che quelle arretrate - ma alla fine la sua sperimentazione si dà la prova convincente. Effettuato in questo stile, tuttavia, non è un argomento ben compreso. Regolarmente la squadra LMAX sottolinea che fino a venire con test di performance significativi è spesso più difficile di quanto lo sviluppo del codice di produzione. Anche in questo caso la simpatia meccanica è importante per lo sviluppo delle prove giuste. Test di un componente a basso livello di concorrenza non ha senso se si prende in considerazione il comportamento della cache della CPU. Una lezione particolare è l'importanza del test di scrittura contro i componenti nulle per garantire il test delle prestazioni è abbastanza veloce per misurare realmente che cosa componenti reali stanno facendo. La scrittura di codice di prova veloce non è più facile che scrivere il codice di produzione veloce e la sua troppo facile ottenere risultati falsi perché il depliant di prova veloce come componente il suo tentativo di misurare. Se si utilizza questa architettura A prima vista, questa architettura sembra essere per una piccola nicchia. Dopo tutto il driver che ha portato ad esso è stato quello di essere in grado di eseguire un sacco di operazioni complesse, con una latenza molto bassa - maggior parte delle applicazioni non hanno bisogno di correre a 6 milioni di TPS. Ma la cosa che mi affascina di questa applicazione, è che hanno finito con un design che elimina gran parte della complessità di programmazione che affligge molti progetti software. Il modello tradizionale di sessioni simultanee che circondano un database transazionale isnt privo di fastidi. C'è di solito uno sforzo non banale che va nel rapporto con il database. strumenti di mappatura Objectrelational possono aiutare a gran parte del dolore di trattare con una banca dati, ma doesnt che fare con tutto questo. La maggior parte di ottimizzazione delle prestazioni delle applicazioni aziendali comporta futzing giro con SQL. In questi giorni, è possibile ottenere più memoria principale per i server di noi vecchi ragazzi potrebbero ottenere come spazio su disco. Sempre più applicazioni sono perfettamente in grado di mettere tutto il loro lavoro creato nella memoria principale - eliminando così una fonte di complessità e lentezza. Evento Sourcing fornisce un modo per risolvere il problema durevolezza per un sistema in memoria, in esecuzione tutto in un unico filo risolve il problema di concorrenza. L'esperienza LMAX suggerisce che, fintanto che avete bisogno di meno di qualche milione di TPS, youll hanno abbastanza headroom prestazioni. Vi è una considerevole sovrapposizione qui con il crescente interesse per CQRS. Un evento di provenienza, in memoria del processore è una scelta naturale per il comando sul lato di un sistema CQRS. (Anche se la squadra non LMAX fa attualmente uso CQRS.) Che cosa indica non dovreste andare su questa strada Questa è sempre una domanda difficile per le tecniche poco conosciute come questo, dal momento che la professione ha bisogno di più tempo per esplorare i suoi confini. Un punto di partenza, tuttavia, è di pensare alle caratteristiche che favoriscono l'architettura. Una caratteristica è che si tratta di un dominio collegato in cui l'elaborazione una transazione ha sempre il potenziale per cambiare il modo in quelli seguenti vengono elaborati. Con le operazioni che sono più indipendenti l'uno dall'altro, ce n'è meno bisogno di coordinare, in modo da utilizzare processori separati che funzionano in parallelo, diventa più attraente. LMAX concentra sul calcolare le conseguenze di come gli eventi cambiano il mondo. Molti siti sono più di prendere un archivio esistente di informazioni e rendendo varie combinazioni di tali informazioni al maggior numero di bulbi oculari in quanto possono trovare - ad esempio, pensare a qualsiasi sito supporti. Qui la sfida architettonica spesso incentrato su ottenere i cache destra. Un'altra caratteristica di LMAX è che questo è un sistema back-end, quindi è ragionevole considerare come applicabile sarebbe qualcosa che agisce in modo interattivo. applicazione web sempre più stanno aiutando noi abituiamo a sistemi server che reagiscono alle richieste, un aspetto che non si adattano bene con questa architettura. Dove questa architettura va oltre la maggior parte di tali sistemi è il suo utilizzo assoluta delle comunicazioni asincrone, con conseguente le modifiche al modello di programmazione che ho descritto in precedenza. Questi cambiamenti avranno un po 'di tempo per abituarsi per la maggior parte delle squadre. La maggior parte delle persone tendono a pensare alla programmazione in termini sincroni e non sono abituati a trattare con asincronia. Eppure il suo lungo stato vero che la comunicazione asincrona è uno strumento essenziale per la risposta. Sarà interessante vedere se l'uso più ampio della comunicazione asincrona nel mondo javascript, con AJAX e Node. js, incoraggerà più persone a indagare su questo stile. La squadra LMAX rilevato che, mentre ci sono voluti un po 'di tempo per adattarsi allo stile asincrona, divenne presto naturale e spesso più facile. In particolare la gestione degli errori era molto più facile da affrontare in questo approccio. Il team LMAX sente certamente che i giorni del database transazionale coordinamento sono numerati. Il fatto che si può scrivere software più facilmente usando questo tipo di architettura e che venga eseguito in modo più rapido elimina gran parte della giustificazione per la banca dati centrale tradizionale. Da parte mia, ho trovato questo una storia molto emozionante. Gran parte del mio obiettivo è quello di concentrarsi su un software che modelli domini complessi. Un'architettura come questo fornisce una buona separazione degli interessi, permettendo alle persone di concentrarsi su Domain-Driven Design e mantenendo gran parte della complessità della piattaforma ben separati. La stretta accoppiamento tra oggetti di dominio e database è sempre stato un irritazione - approcci di questo tipo suggeriscono una via d'uscita. se hai trovato questo articolo utile, si prega di condividerlo. Apprezzo il feedback e encouragementThe Matematica in Architettura - PowerPoint PPT Presentazione Trascrizione e presentatori Note Titolo: la matematica in Architettura 1 La Matematica in Architettura L'intera presentazione è dedicato a come la matematica si adatta all'architettura. 2 Storia della matematica in architettura Nei tempi antichi l'architettura era un campo della matematica. Gli architetti sono stati matematici semplicemente che qualcuno voleva assumere. La prima volta che l'architettura è stato menzionato nel testo, era circa le piramidi egizie. Vi è un numero d'oro in architettura è (1square radice 5) 21,618,033989 millions (1,618,033989 millions) 51degrees 50 minuti, le piramidi egizie si basano su questo numero. Non sappiamo se si trattasse di tentativi ed errori o se avevano già scoperto il numero d'oro. 3 La Pitagora Il Pitagora erano uno dei primi influssi sull'architettura. I numeri in loro cultura ha avuto un significato religioso. Il Pitagora ha preso la teoria musicale fondamentale (che hanno creato), che è il suono di una stringa fa dipendente dalla sua lunghezza, che cosa questo cavo al era l'unità di lunghezza di base per la costruzione di strutture. 4 Where math fits in Every building is measured and level which involves very basic math, In more complex buildings, for an example the Eiffel tower, it needed to be a perfect triangle and have its special curves at a special angle. Also it weighs many tons so it needed to be able to support its own weight. As you can see there are many different types of math needed, which include trigonometry basic measurements proportion and complex multiplications. 5 Obstacles solved with math In Asia there is a building that is very tall and was in danger of earthquakes. They decided to put a giant pendulum in the tower to keep it from tipping or losing its stability. Many buildings are aerodynamically designed so decrease air drag, so that they dont sway too much causing uncomfort or sickness to the people in them, or in very serious cases failure of the building structure. 6 Modern Architecture In the modern era, there is much less calculation done by people. It is all done with computer programming. It could be as simple to bringing the building up to scale, or even to find out how many diamond shaped pieces you needs for a certain area on the building. Computer programming allows us to be much more precise in the work that needs to be done, and also puts a lot less stress on the designer. 7 Activity I will make groups of three or four for this activity. There are so many building shapes youll be given and you have to make the most aerodynamicstructur ally secure building you can make. 8 Questions What is the angle of the pyramids (among many modern buildings). This angle is used to find a certain number Why must skyscrapers be aerodynamic What significance did numbers have for the Pythagoras Why do we now use computers for architecture as a planning tool 9 Answers The angle is 50 degrees and 51 minutes. Skyscrapers are aerodynamic to avoid rocking back and forth or maybe even structural damage. The significance is it represented religious beliefs. We use computers because its much more precise, less time consuming and less room for human error. 10 Bibliography gap. system. org-historyHistTopicsArchitectur e. html Semptember 8th 2009 wwwplus. math. orgissue42featuresfrostersinde x. html September 8th 2009 boelgen vejile. dk October 5th 2009 Cache. ebebimageid75854rendType4 October 5th 2009 your-info-hubguitarratateimage. php October 5th 2009 delhivewarminaryanakshardham-temple0 October 5th 2009 PowerShow is a leading presentationslideshow sharing website. Sia che la vostra applicazione è business, how-to, l'istruzione, la medicina, scuola, chiesa, vendite, marketing, formazione on-line o solo per divertimento, PowerShow è una grande risorsa. E, soprattutto, la maggior parte delle funzioni interessanti sono liberi e facile da usare. È possibile utilizzare PowerShow per trovare e scaricare esempio presentazioni PowerPoint PPT online su praticamente qualsiasi argomento si possa immaginare in modo da poter imparare a migliorare le proprie diapositive e presentazioni gratuitamente. O usarlo per trovare e scaricare di alta qualità come fare le presentazioni PowerPoint PPT con scivoli illustrati o animati che vi insegnerà come fare qualcosa di nuovo, anche gratuitamente. O usarlo per caricare le proprie diapositive di PowerPoint in modo da poterli condividere con i vostri insegnanti, di classe, studenti, dirigenti, dipendenti, clienti, potenziali investitori o il mondo. O utilizzarlo per creare presentazioni di foto davvero cool - con transizioni 2D e 3D, l'animazione, e la vostra scelta di musica - che è possibile condividere con i tuoi amici di Facebook o cerchi di Google. Questo è tutto gratuito anche per una piccola tassa è possibile ottenere i migliori industrys privacy online o pubblicamente promuovere le presentazioni e le presentazioni con i posti superiori. Ma a parte questo il suo libero. Bene anche convertire le presentazioni e presentazioni in formato Flash universale, con tutto il loro splendore multimediali originali, tra cui l'animazione, gli effetti di transizione 2D e 3D, la musica incorporato o altro audio, o anche video incorporato nelle diapositive. Tutto gratis. La maggior parte delle presentazioni e slideshow su PowerShow sono liberi di vista, molti sono ancora da scaricare gratuitamente. (È possibile scegliere se consentire alle persone di scaricare le presentazioni di PowerPoint originali e presentazioni di foto a pagamento o gratuitamente o per niente.) Partenza PowerShow oggi - gratis. C'è davvero qualcosa per le presentazioni tutti gratuitamente. O usarlo per trovare e scaricare di alta qualità come fare le presentazioni PowerPoint PPT con scivoli illustrati o animati che vi insegnerà come fare qualcosa di nuovo, anche gratuitamente. O usarlo per caricare le proprie diapositive di PowerPoint in modo da poterli condividere con i vostri insegnanti, di classe, studenti, dirigenti, dipendenti, clienti, potenziali investitori o il mondo. O utilizzarlo per creare presentazioni di foto davvero cool - con transizioni 2D e 3D, l'animazione, e la vostra scelta di musica - che è possibile condividere con i tuoi amici di Facebook o cerchi di Google. Questo è tutto gratuito anche per una piccola tassa è possibile ottenere i migliori industrys privacy online o pubblicamente promuovere le presentazioni e le presentazioni con i posti superiori. Ma a parte questo il suo libero. Bene anche convertire le presentazioni e presentazioni in formato Flash universale, con tutto il loro splendore multimediali originali, tra cui l'animazione, gli effetti di transizione 2D e 3D, la musica incorporato o altro audio, o anche video incorporato nelle diapositive. Tutto gratis. La maggior parte delle presentazioni e slideshow su PowerShow sono liberi di vista, molti sono ancora da scaricare gratuitamente. (È possibile scegliere se consentire alle persone di scaricare le presentazioni di PowerPoint originali e presentazioni di foto a pagamento o gratuitamente o per niente.) Partenza PowerShow oggi - gratis. There is truly something for everyoneThe history of information systems (IS) only span five decades. Yet from its inception, IS has done more to expand business and industry into global markets than any other convention in history. Today the backbone of IS is know as the World Wide Web, Internet, or with a business a Local Area Network, along with lists of acronym buzz word EDI, EIS, ERP, SCM and host of others to describe new ways in which IS can be employed to grow business. Contrary to the speed of information today, just over forty years ago, the business climate in United States was experiencing post-war growth much like it had never seen. Much of the experience that grew the economy had been learned during World War Two in tooling up the nations industries into producing an effective war machine. The field that developed out of this push to win the war was Operations Research (OR). When the war end those involved with OR were released from government work, thus unleashing an experienced and highly skilled field, like no other in history, into business and industry, which launched the US into a era of prosperity and growth that lasted over twenty-years. World War Two also saw the birth of the first practical computers or Turing Machines, which were responsible for cracking the German codes and giving the allies advanced warning of enemy movements. By todays standards these first practical computers were not that practical, half a million dollars and far less powerful than a pocket calculator which today purchased for under ten dollars. However these first computers gave Operations Researchers the power they needed to begin simulate larger and more complicated systems which in business and industry help greatly to hone uses capital expenditures into profitable ventures. This background from the early days of simulation, OR, and new technologies birthed studies into the areas of what became known as Information Systems. When and how were they first used Formalized By the mid-sixties IS was already forging its way into business mainstream. While computers remained out of reach for most businesses, telecommunications made its mark with the TELEX machine. This step gave businesses the ability to communicate within its own organization anywhere in the world at any time and effectively pass instructions and information. The use of computer in business and industry usually started off in the accounting departments. It was assumed that this area would know the most about using numerical machines and the lack of understanding in how important databases could be other areas of the business. By this time a number of business school began developing Management Information System (MIS) programs to meet the growing need of IS managers. During the seventies more upper management recognized the importance of IS and the flexibility it was bring to business. The TELEX became the standard of information transfer and the mainframe computer became the standard for database creation. As the need for organized and easy access to data became apparent, information based businesses began moving the mainframes from under the accounting management to it own department. Approaches toward IS Design and Why As IS begins to receive its own autonomy and large budgets in corporations, many technical savvy managers of these new departments begin spending huge amount of money on systems and software at their own discretion and many time out spend all other departments without any returns to the business. These were troubling and risky times for CEOs deciding to direct the business into IS based systems. The systems and software were complex, continually changing, and the people that knew the systems tended have their own agendas. Out of this turmoil came the basis of how IS develops with in businesses. Mainframes Vs PCs This new rush in what is now referred to as e-mail, was brought about by the invention of the mini and micro computer, which could put and entire system on an executives desk for a very low price compared to mainframes and the ability to have an autonomous system with out pay huge amounts of money to process information. Once again turmoil enters the relationships of IS and businesses, where software and hardware vendors begin making demands on businesses to switch there style of business to fit the computer systems. There was little standardization of software and hardware with many start up companies that went under there after leaving business with out any technical or system support, resulting in spending above budgets to install entirely new systems. As the desire to support different departments of a corporation with IS and the new affordability of hardware and software each department began to put IS programs together independently of MIS department. This result in a new position in companies: Chief Information Officer (CIO), a position that in many companies at this time rivaled the CEO. The need for this position was to standardize all of the electronic data interfaces (EDI) between all departments so information could be more efficiently. Quality Initiatives in IS Development The mid-eighties were the time most manufacturing companies began to shift to IS to forecast sales, take orders, and manage distribution of products. Time Berners-Lee developed the World Wide Web in 1989. This protocol HTML used over the existing Internets that had been constructed opened up a new era of EDI the world had never seen. Where by the mid-1990s it became apparent that there is no way for a corporation to efficiently do business without a solid functioning IS setup inside its own walls as well as connected with its supply-chain vendors and distributors. EDI once known as Electronic Data Processing (EDP) have now brought profit margins so low that any business that does not prepare itself will be out of business in the next five years. IS is a technology driven system. With out it, business would not be what it is today. It has evolved over the past forty years to being the back bone of business, yet the simple application rules created in the 1960s and 1970s are still very relevant in any application where data or information is transferred in what ever business model it is applied to no matter the complexity. Home CHAPTER 3 INFORMATION SYSTEMS - AN INTRODUCTION (TM) Basically an Information System handles the flow and maintenance of information that supports a business or some other operation. It contains information about significant people, places and things within the organization or in the environment surrounding it. Information is derived from meaningful interpretation of data. Data consists of the raw facts representing events occurring in the organization before they are organized into an understandable and useful form for humans. An Information System can be defined technically as a set of interrelated components that collect (or retrieve), process, store and distribute information to support decision making and control in an organization. Another definition of an Information system (by Buckingham et al (1987b) is. A system which assembles, stores, processes, and delivers information relevant to an organization (or to a society), in such a way that the information is accessible and useful to those who wish to use it, including managers, staff, clients and citizens. An information system is a human activity (social) system, which may or may not involve the use of computer systems. Also, in addition to supporting decision-making, information systems help workers and managers to analyze complex problems, to develop new products and to integrate the various modules and departments. Moreover the transmission lossesn inter-departmental communication are reduced considerably leading to better coordination and improved transparency (information sharing) within the organization as a whole. Three activities provide the information that organizations need. These activities are Input, Processing and Output. Input consists of acquisition of the raw data, which is transformed into more meaningful packets of Information by means of Processing . The processed information now flows to the users or activities also called as Output . The shortcomings are analyzed and the information is sent back to the appropriate members of the organization to help them evaluate and refine the input. This is termed as feedback . Examples of Information Inputs would be Transactions, events which would undergo processing in the form of sorting, listing, merging and updating resulting in outputs such as detailed reports, lists and summaries. Another example would be in the manufacturing environment with information inputs such as design specs material requirements and the SOPs (standard operating procedures). These would be processed by the information system by modeling and simulation techniques and would result in standard production models along with the overall cost of the production process which is calculated by the information system from the knowledge base containing material costs, hourly labor costs and other indirect costs. Hence almost totally eliminating a distinct costing function in the scheme of things. However an information system cannot just be broadly described as an Input-Process-output mechanism in vacuum. It is required to provide major organizational solutions to challenges and problems posed in the business environment. Hence a manager needs to be not just computer-literate but also have a good idea of the organizational structure and functions as a whole. This concept is illustrated in the figure on the opening page. Also, at the heart of the issue Information systems should not be confused with information technology . They exist independent of each other and irrespective of whether they are implemented well. Information systems use computers (or Information Technology) as tools for the storing and rapid processing of information leading to analysis, decision-making and better coordination and control. Hence information technology forms the basis of modern information systems. 3.1 Types of Information Systems Types of Information systems (Source: Management Information Systems, Laudon and laudon) The six major types of information systems corresponding to each organizational level (the four levels shown in figure above) are: 1. Transaction Processing Systems (TPS): serve the operational level of an organization. 2. Knowledge work systems (KWS) 3. Office automation systems (OAS) to serve the knowledge level of an organization. 4. Decision-support systems (DSS) 5. Management information systems (MIS) serve the management level of the organization. 6. Executive support systems (ESS) serve the strategic level of an organization. (Source: Management Information Systems, Laudon and laudon) CHAPTER 4 DEVELOPMENT OF INFORMATION SYSTEMS (TM) As mentioned earlier, every company to start with, has an information system already in place, be it a file card and pencil based system, a computerized system or an intermediate of the two. Hence the IS development process involves work on an existing system - mapping the system, automating it and making sure that it functions according to user requirements. Hence in its first phase the process attempts to determine the scope and type of new system that the user wants. The next phase analyzes the above requirement in two parts to facilitate detailed verification and validation before the system is actually designed and implemented. 4.1 Beginning with the users Infact the entire concept of Information systems development revolves around the users - their needs, performance expectations, requirements and other specifications. The very succcess or failure of an information system may be measured by the level of satisifaction of its basic users in the organisaiton. It is very essential that the database satisfy the requirements of the user, otherwise he or she will continue with his or her own system and thereby defeat the purpose of the central database. The key element in this concept is that each subsystem utilize the same database in the satisfaction of its information needs. This will yield an additional significant advantage - the integration of departments and functions. Thus each department, through its access and interface with the total information resources of the company, gains a greater understanding and appreciation of how its actions and plans affect others throughout the organization. An important question that can be raised is why is it important to analyzeand design information systems before you build them. Why cant you build the information systems directly The main reasons are: 1. It is important to build the information systems that the users really need. You dont know what they really need if you dont start with some kind of analysis and design. 2. It is a waste of resources to build information systems without sufficiently good blueprints because it takes more time and yields worse results if you dont have blueprints. Analysis and design is performed to meet information needs. If it is required to arrive at models that describe information systems that the users really need, then interest groups (or user groups) generally have to participate in the work. Another reason for performing analysis and design is that those who participate in such work learn much about the new information systems. To be able to use information systems requires knowledge about how these systems work. Participating in the analysis and design work is one way of obtaining such knowledge. 4.2 Determining need and performance expectations As every company has an existing system and the process of IS development involves system conversion. The general steps involved in the conversion are: 1. System Description (narrative or pictorial) 2. Input Documents ( item description, layouts etc.) 3. Output Documents ( report formats, output requirements etc.) 4. File Design (involves the system design process explained in the next section) 5. Program Logic (by the use flow charts or other methods) 6. Computer Program (COBOL, DYNAMO, BASIC, PASCAL, FORTRAN to name a few ) 7. System Verfication 8. Documetation Potential problem requirements surrounding database construction are generally those connected with interdepartmental coordination and agreement. These might include. - possibility of invalid input of information by a unit wishing to maintain information security. - the multiplier effect of erroneously entered data, which has an immediate influence on other departements utilizing the data. - the time dimension of input data, which requires that user departments agree on the time during which a transaction should be reflected data input. - the interdepartment agreement required concerning the degree of detail to be included in data elements of the database. As a consequence of the above problems that have been identified some of the desired features of the system would be. - Simplicity or ease of usage and handling (by employing graphic user interface - based entry and retrieval systems) - Adequate security featuresfirewalls for restricitng unauthorised access (both within the organisation and on the web) and - A very rigid backbone-operating system to support the numerous organizational functions at different levels. A clear-cut knowledge of the expectations or requirements of the system being developed would entail a listing of some performance metrics. The measurement of costs or benefits is a measurement of change between the old and the new. In other words we may measure the change in the total output of the system or measure the many changes accomplished throughout the system. The former is obviously the most desirable. It is probably rare that a measurement of the total system is attempted at the system level. Some broad concepts that need to be kept in mind during system development include. 1. System Integrity . How well are the sub systems integrated into the total system without redundancy. How flexible is the system. How easily may the system be expanded. 2. Operating Integrity . How skilled are the people operating the system What back-up is there to prevent system breakdown in the event of loss of key personnel or equipment failure. 3. Internal Integrity . How well does the system do what it is supposed to do. How valid are system outputs. How secure is the sytem against human error, manipulation, sabotage or theft. 4. Procedural Integrity . How good is the documentation of the system and procedures. Are procedures such that employees are motivated to follow them. How well are procedures followed in practice. What controls ensure that procedures are followed. - Change analysis has to be performed before information systems development is performed. Change analysis is the analysis of suitable changes of the activities of an enterprise in concrete situation. The purpose of change analysis is to formulate the problem before you start to solve it. Developing information systems is effective only if you have information system problems or needs. Problem oriented work must be performed before data oriented work is performed. Problem-oriented work in information systems development refers to the development parts whose purpose is to specify what the information systems will do (seen from the users view). Data-oriented work refers to the development parts whose purpose is to design technical solutions to this specification. It is only effective to perform data oriented work if you have a problem-oriented specification as a basis. The concept is explained in further detail in the first phase of process design,( i. e requirements analysis.) 4.3 Characteristics of good organisational IS talent A manager needs information for a variety of reasons concerned with the management process. The type of need that he or she will have at various times and for various purposes depends largely upon 2 factors that we shall examine briefly. the personal managerial attributes and the organizational environment in which decisions are made. 1. Knowledge of information systems If managers are aware of what computer-based systems can do, their information requests will probably be more sophisticated and more specific. Their knowledge of capabilities and costs places them in a much better position to aid in the design of a good system. 2. Managerial Style A managers technical background, leadership style, and decision-making ability all affect the kind and amount of information required. Some prefer a greater amount Others like to decide with a minimum of detail and prefer personal consulatation with subordiantes. 3. Managers perception of information needs You tell me what I need to know and get me all the facts represent two opposite perceptions of information needs. This dichotomy is due partly to the fact that many managers are ignorant of what information they need. Another dimension of the problem is the widely differing views of the managers regarding their obligation to disseminate information to subordinates and to groups outside the firm. Teh manager wh ocannot or will not delegate authority is likely to keep information closely held. 1. Nature of the company Problems in communication and in controlling operations seem to be a function of the comapnys size and the complexity of its organization. The larger more complex firms require more formal information systems, and the information needs of these systems become more critical to operations. 2. Level of Management There are three levels of management (i. e strategic planning, management control, operation control) and the varying needs for information at each. Each level needs different type of information, generally in different form. top levels need the one-time report, the summary, the single inquiry. The management control level needs the exception report the summary and the variety of periodic reports for regular evaluation. The operational control level requires teh formal report with fixed procedures, the day-to-day report of transactions, to maintain operational control of actions as they occur. Managers at all levels have changing information needs, depending on the nature and importance of the particular decision. 3. Structure of the organisation The more highly structured the organization, the easier it is to determine the information needs. Where authority and responsisbility are clearly speelled out, relationships understood, and decision-making areas defined, the information needs of managers can be determined more easily. (Above section adapted from Information systems for modern management by Murdick, Ross and Claggett) 4.4 Stages In Process Design: The Process of information systems development in its first phase attempts to determine the scope and type of system the user wants. The next phase analyzes the above requirement in two parts to facilitate detailed verification and validation before the system is actually designed and implemented. This stage consists of obtaining user needs and requirements which reflect the user-expectations from the IS being developed. It consists of several stages: 1) Problem definition 2) Feasibility Study 3) Requirements Acquisition 4) Requirements Analysis The problem definition and feasibility study stages consist of definition of a bare outline of the desired system. The Problem Definition Stage defines to a high level of detail the application for the desired IS and an indication of the advantages that will result from its implementation. The Feasibility Stage is the examination of the different alternatives with which a solution can be found for the design of the desired system. The Requirements Acquisition Stage results in a statement of requirements. The Requirements Analysis stage produces the requirements specification. Using the statement of requirements as the main input the aim of the requirements specification is to act as an overview of the desired system in a structured form. This phase analyzes the requirements from the previous phase and converts them into components, which are used to build a specification of the desired system. The specification is more precise than in the previous phase and adds more detail, at the same time retaining user semantics, so that the description would be recognizable to the user. However the model is at an abstract level, that is, with no details concerning data representation or computer implementation. This phase produces a design of the desired system that will serve as a basis for computer implementation. There are two major tasks in logic design. Firstly the specification from the analysis phase is transferred and secondly the human computer system is designed. The significant difference in this phase is that the structure component is now represented by data. There will often be several possible ways of representing relationships. We may also use normalization in this phase. We decide exactly what data types are required for data representation, how many characters are required for each data item and we design records and files or databases to store the data, taking into account the type of processes that will operate the data. An abstract programming form is often used here, such as structured English, JSP diagrams or action diagrams. In addition DFDs may be drawn showing the processes that occur, the data input to and output from each process etc. The second major task in logical design consists of design of human computer systems. Two levels of detail are normally considered here: - Design of user procedures which consist of tasks and processes with which users will be directly involved - Computer interface design consist of the detail of processes and the objects on which these processes operate, and may involve considerations related related to interaction style ( screen and report layouts, human-computer dialogues), specifications of manual or mechanical operations, and off-line or online processing. This is the last of the design phases. We may consider it as consisting of 3 components: Hardware, software and human-computer systems. The hardware design consists of a description of the computers, storage devices, inputoutput devices and possibly networking devices required for the desired system. Software consists of the programs that run on the hardware. The physical design of data needs to be considered as the kind of data invariably affects the programs that process the data. It will be necessary to decide on the appropriate types of applications software, including languages and packages as well as systems software required for supporting the eventual system. There are four options for process design 1. For standard processes, we can buy packaged software. For example, accounting software is largely standardized. 2. Use of a fourth-generation language such as lotus123, VB, Oracle etc. 3. Generate code using a CASE tool 4. Write our own code. If in-house coding is done data structures are chosen for the representation of data in the programs, together with decisions as to the programming language required for eg. COBOL, C etc. Issues such as execution speed and ease of maintainability of program code are considered. Human Computer system design Some of the design of this system specifies the activities to be followed when communicating with the computer, for example, detail of dialogue between computer and operator, procedures for starting-up and shutting down the system and screen contents such as windows or colors etc. Implementation And Testing The major output of the implementation and testing phase is a physical information system and not a design. Of course the physical and earlier designs remain available for reference, as they form the specification. The major tasks consist of: Acquiring and integrating hardware, producing software, generating data for the files or databases and producing the human-computer system. System is tested, user comments are evaluated, perhaps to redesign the system. The operation of the implemented system in the user-organization if monitored closely for a limited period. Maintenance The maintenance phase consists of correcting errors in the system or responding to changes in the user requirement, due, for example, to environmental changes or personal preferences for system operation and it may require reworking of all the previous phases for the part of the system that requires changing. 5.1 System Design The basic information model consists of three parts as shown below and the data dictionary. The external models represent the user views of the system. These are brought together into a single global conceptual model as illustrated below. The conceptual model does not take into consideration how the data and processes will be implemented on the computer. This is accomplished through the internal model (shown as schemas and programs in the diagram below) 5.2 Stages in IS modeling As mentioned earlier, we do not design the internal model right away. A conceptual information model is first formulated and this is then translated into an internal model. Also we need to develop two conceptual models (a) A conceptual data model and (b) A conceptual process model. These are then checked for consistency and, any necessary modifications are made to arrive at the data processing model. This is the first level information model. (the data model, the process model and the data processing model) otherwise called first level design . Second level design is concerned with adapting the first level design to the specific requirements of the processing required. It may be that the first level design consists of so many relations that it would not achieve an acceptable level of performance if it were implemented in that form. Hence the model may need flexing to accommodate the demands of the functions which the information system may support. The result of this is the second level design information model. The final stage is the third level design where the model is mapped into the internal schemas required by the software being used to implement the system. The process of moving form first to second to third level design may seem rather long but it is important for a number of reasons. The first level will provide a transaction-independent view of the information content of the system. However it will still be enterprise-dependent because the data model will only reflect the things of interest to that enterprise. The second level design is enterprise or transaction dependent, but is still independent of hardware and software. Hence the second level can be used to evaluate alternative implementations and assist in the selection of hardware and software. Third level design is enterprise, transaction and software dependent. The process of design is shown in the diagram below. IT is important to note that this process does not equate the design of the entire information system. In particular it does not cover data on establishing the feasibility of an IS, nor on strategic decisions involved in selecting an information area. Similarly nothing is said about the design of forms, codes, screens and reports nor of the techniques for the analysis of the requirements of the users. 6.1 System Development Methods (MR) ( Source. Yourdon system methods, model driven methods, 1993) The evolution of system development methods has been gradual. The three stages in the evolution of system development methods may be identified as. 1) First generation methods. 2) Second generation methods. 3) Third generation methods. First Generation Methods These methods includes various structured techniques developed during late 1960s and 1970s. Structured techniques breakdown a complex problems into smaller components with well defined inter-relationships between components. DIVIDE and RULE Components of First generation methods: 1) Structured programming. 2) Modular design and structure charts. 3) Programming style. Modular design . many programming languages allow groups of statements to be reused, such a group of statements are called program module and their use is referred as modular programming. structure charts show how modules are connected to form a program. Programming style . using standard constructs, code can be complex and difficult to understand and it was also understood that maintainable code also required style guidelines ( 1970s). Data Structures . data design tech. used in 1970s were pragmatic ways of building data structures and files to support programs. CODASYL organization was upfront in database design in late 60s. Structured Design . structured programming technique only addresses design in small. these never gave any guidelines on how to carry out design in the large. Successive refinement (Top Down Functional Design): A required system function was broken-down to smaller number of tasks that could be combine to accomplish the function. Each of these were in turn broken down into smaller sub-tasks. The process was continued until the subtask was so simple that it could be coded with little chance of error. Techniques based on the semantics of the structure chart Main criteria for improving program design were based upon. Coupling: measures the complexity of interfaces, If interfaces between module are simple, design is described as having low coupling. Cohesion: measure of how single-minded a module is. If module carries out exactly one well defined function it is described as having functional cohesion. Data Refinement . Relation data model, which treats all the data as tables. Refinement criteria were used to check the quality of design. Application of these criteria is called normalization. Structured Analysis . The set of tools and techniques referred to as structured analysis were developed to address the problem of identifying and stating the user requirement in an unambiguous, understandable form. These techniques were mainly Process-oriented concentrating on required system functions. Modeling tools . The main need was for modeling tools that would help to partition complex requirements into smaller units with well defined inter-relationships. The modeling tools used were. 1) Data Flow Diagrams to show the portioning of proposed system into smaller functional areas or mini-systems. 2) Mini-specs to specify each mini-system. The use of review sessions, where part of the requirements was also presented was a key technique capturing user requirements. These review sessions were termed as structure walkthroughs. Information Modeling: at the same time as structure analysis were developed, a semantic approach to information modeling was formulated. This was based on real-world entities and relationships. Problems with top down functional decomposition (TDFD) : Top down functional decomposition was carried out by trying to guess what main functional area were. Each functional area was then examined in turn and successively broken down until the functions were simple enough to verify with the user. This lead to second problem that caused TDFD to be supplemented or replaced in the second generation methods. Correct partitioning of the system could not be done until system was understood and system couldnt be understood until it had been partitioned. Because of this problem an optimal statement and organization of the user requirement was very time consuming, required considerable reworking of the models and due to time pressure it compromise on quality of work. TDFD is creative technique and reflects the way the analyst thinks or perceives the system. The logical model tends to reflect the unconscious bias of analyst towards a specific solution. Fragmentation of Policy Although there were guidelines that helped identify the best organization of the user requirements, it was sometimes found that functions which were widely separated in the model needed to be cross-checked. Different system development philosophies: 1) Process and data driven methods. 2) Phase oriented and model oriented development. Process oriented: concentrating on system functions and regarding the data as only being present to support system functions. Data Driven methods: Concentrating on information requirements, particularly in terms of identifying the data to be stored in database. Systems functions were considered to be less important. Phase oriented. System development life cycle was seen as sequence of phase, each consisting of well defined activities that had to be carried out. Model oriented. here life cycle was seen as a sequence of models of system requirements. Each model had a defined structure that could be checked. Second Generation Methods In First Generation (FG) methods developers were process oriented or data oriented and used modeling in fairly informal way. In all Second generation methods main stress is on the construction and checking of models. FG methods are largely independent approaches for dealing with each stages of system development life cycle. Second Generation methods provide a smoother development path from requirements analysis to later design and implementation stages. FG model is used to capture system requirements in policy terms, later models elaborate on how the model is mapped onto available technology because models are not independent but each model evolves into the next, taking into account another layer of technology. FG methods viewed system from one viewpoint with relative poor modeling from other viewpoints. SG methods regard system functions and data as two equally important aspects the system. Second generation methods were externally oriented. Analysis techniques are based on real world requirements of two types a) response to real world events and b) store information about real world entities. Real World Events. Time is more explicitly modeled in terms of events that occur in the environment of system. System behaves as they do only because of these events that occur and requires policy for responding to these events. Real World Entities. By collecting information about real world entities and the relationships between them, the analyst avoids bias towards any possible data storage organization. CASE (Computer Aided Software Engineering ) Use of CASE was not common until 1980s although such tools become available from about 1975.Some case products have draw what u want approach and some have more well defined grammar that the diagrams can be checked against. The second generation technique are mainly Diagram Oriented unit of modeling is a diagram. Diagrams are drawn and checked. Reasons For Third Generation Methods The second generation view of models is rather low-level. It deals with individual diagrams rather than the larger issues of how individual analysis and design unit fit together and interact. Third generation methods will be distinguished by a philosophy that is more concerned with the whole rather than parts. 6.2 Techniques (TM) An information systems development methodology can be defined as a collection of procedures, techniques, tools and documentation aids that will help the systems developers in their efforts to implement a new information system. A methodology will consist of phases, themselves consisting of sub-phases, which will guide the systems developers in their choice of techniques that might be appropriate at each stage of the project and also help them plan, manage, control and evaluate IS projects. Methodology . As defined above it basically represents a way to develop IS systematically. Techniques: May involve the use of one or more tools which represent some of the artifacts used in information systems development. Tools . Tools are usually automated, that is, computer tools normally software to help the development of an IS. Techniques may be used in common among several methodologies. However they are not interchangeable because when used in a particular methodology they could address different parts of the development process, be used for different purposes or be applicable to different objects. Listed below are the techniques used in the information systems development process: 1. Rich pictures 2. Root Definitions 3. Conceptual models 4. Entity modeling 6. Data flow diagramming 7. Decision trees 8. Decision tables 9. Structured English 10. Action diagrams 11. Entity life cycle 12. Object orientation 13. Structure diagrams The above table shows the position or stage in the development where any particular technique is utilized and whether it is primarily regarded as general, or data or process-oriented. The asterisk indicates the IS development stage or stages (discussed previously) in which the technique is most commonly used. For example entity modeling is used in two stages but its use at the logical design stage is most common. Tools (especially automated tools) are available in plenty for the system development process. Listed below are a few tools classified (and thereby defined) into some significant groupings. 1. Project management tools 2. Database management systems 3. Data dictionary systems 4. Systems repositories 5. Drawing tools 6. CASE (computer aided software engineering) tools Methodologies for information systems development make use of some of the process-oriented techniques of functional decomposition such as data flow diagrams, decision trees, decision tables and structured English. Functional decomposition gives structure to the processes reflected in particular by the most important technique of data flow diagrams. This emphasis on structure gives the name of the first methodology STRADIS. Some of the several methodologies proposed for IS development include: STRADIS (Structured Analysis And Design of Information Systems) follows the Top-down approach (functional decomposition) for analyzing processes. YSM (Yourdon Systems Method) Although, at the outset, this was very similar to STRADIS it differs in the more recent versions wherein it follows a middle-up approach to analyzing processes also called as event partitioning, which is more appropriate than the top-down approach. As a result of some such features as the above and also due to better ease of understanding and clarity of depiction, we employ the YSM in our future study and analysis of IS in industry. IE (Information Engineering). Whereas the fundamental techniques of the above two process-oriented approaches are functional decomposition and data-flow diagrams, the basic approach in IE is the data-oriented entity relationship approach. SSADM (Structured systems analysis and design methodology). It can be said to be the modern version of the traditional Information systems development life cycle approach. It includes the techniques of data flow diagramming and entity life histories, and recommends the use of tools, such as CASE tools and workbenches. Merise Unlike as in the previous methodologies wherein emphasis has been placed on either process or data aspects, Merise has been designed such that both are considered equally important and these aspects are analyzed and designed in parallel. JSD (Jackson Systems Development) is the development of Jackson systems programming (JSP) (which has had a profound effect on the teaching and practice of commercial computer programming.) into systems development as a whole. This methodology concentrated on the design of efficient and well-tested software, which reflect the specifications and is particularly applicable where efficiency is of paramount importance, for example in process control applications. Object oriented Analysis. This approach reflects the view that in defining objects and their component parts (attributes) we capture the essential building blocks of information systems. Also it is a unifying approach as analysis and design can be undertaken following this approach. ISAC (Information Systems Work and Analysis) This methodology seeks to identify the fundamental causes of users problems and suggests ways in which the problems may be overcome (not necessarily through the use of computer information systems) by the analysis of activities and the initiation of change processes. It is therefore a people-oriented approach with emphasis on the analysis of change and the change process. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald) ETHICS ( Effective Technical and Human Implementation of Computer based Systems). Also a people-oriented approach and encompasses a socio-technical view that, in order to be effective, the technology must fit closely with the social and organizational factors in the application domain. SSM (Soft Systems Methodology). Whereas most of the earlier approaches stress on scientific analysis, breaking up a complex system into its constituent parts to enable analysis, systems thinking might suggest that properties of the whole are not entirely explicable in terms of the properties of its constituent elements. SSM addresses the fuzzy, ill-structured or soft problem situations which are the true domain of information systems development methodologies, not simple technical problems. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald) Multiview is a hybrid methodology that brings in aspects of other methodologies and adopts techniques and tools as appropriate. Basically a contingency approach. techniques and tools being used as the problem situation demands. Process innovation does most to tie business process reengineering with information technology and information systems, IT being seen as the primary enabler of process innovation as it gives an opportunity to change processes completely. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald) RAD (Rapid application development) is in response to the need of rapidly changing business environments. It is usually enabled by CASE tools and systems repositories. KADS is the outcome of a European research project to develop a comprehensive, commercially viable methodology for knowledge-based systems construction.. Euromethod also results from a european initiative and is more of a framework for the procurement and management of services for the investigation, development or amendment of information systems than methodology. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald)CHAPTER 7 SYSTEM DESIGN AND MODELLING (MR) 7.1 Business Process Redesign (Ref: Engineering management review (Vol 26,number 3, fall) Business Process Redesign is defined as the critical analysis and radical redesign of existing business processes to achieve breakthrough improvements in performance measures. In 90s 2 tools revolutionised the organisations these were. 1) Information Technology 2) BPR ( Business Process Redesign ) IT . This includes the capabilities offered by computers, software and telecom. IT is considered as analysis and modeling tool. Thinking about IT should be in terms of How it supports new or redesigned business processes. Use of IT in Manufacturing Industries. a) Process Modeling. b) Production Scheduling and Controls. c) Materials and Management Information Systems. Business Process ( BP ) . Business processes are defined as set of logically related tasks performed to achieve a defined business outcome. Set of business processess forms a business system. Business processes have two important characteristics. a) They have Customers. Recipients of outcome. b) They cross Organizational Boundaries. Five steps in (PD) Process design. 1) Develop Business Vision and Process Objectives. Prioritize objectives and setstretch targets. 2) Identify the Process to be Redesign. To find out critical processes. 3) Understand and measure existing process. Identify current problems. 4) Identify IT levers. To think of new process approach. 5) Design and build a prototype of the process. Implementation. Develop Business Vision and Process Objectives. In past process redesign was to rationalize the process, i. e to eliminate obvious bottlenecks and inefficiencies. Most likely Objectives. Cost Reduction . Important objective with others but insufficient in itself, while optimizing other objectives seems to bring the cost inline but not the vice-versa. Time Reduction . Common approach for reducing time is to make steps simultaneously rather than sequentially, using IT to co-ordinate. Output Quality . Specific measures may be uniformity, variability or freedom from defects. This is mostly defined by customer of the process. Setting goals that will stretch the organization will also provide inspiration and stimulate creative thinking. Identify the processes to be redesigned. Most of organisation could get benifit from IT - enabled redesign of critical (if not all) business process. Two major approaches. Exhaustive approach High Impact approach Exhaustive approach :Attempts to identify all the processes within an organization and prioritize them in order of redesign urgency. High Impact approach . Attempts to identify only most important processes Redesign process should be containing . a) Begining and end points. b) Interfaces. c) Organisation units involved. Understand and Measure existing process . This is required because. a) Problems must be understood so that they are not repeated. b) It can act as a baseline for future improvements. Identify IT Levers . Role of IT in process design should be considered in early stages of redesign. All of IT capabilities involve improving coordination and information access across organizational units, thereby allowing more effective management of task interdependence. Design and Build a prototype of the process . After all the studies and data collection, brainstorming workshops bring a design which also goes through successive iterations. Building a prototype of IT change usually achieves results faster than conventional life cycle. The process design after agreements by owners and stakeholders are implemented on pilot basis ( Parallel with the existing processess) examined regularly for problems and as the process reaches final acceptance, it is phased into full implementation. Defining Process Types : Three major dimensions can be used to define processess, 1) Organisational entities or subunits involved in the process. 2) Type of objects manipulated. 3) Type of activities taking place. Defining Process entities . Inter-organizational Processes. These are the processes where two or more business organization co-ordinates with each other. Inter-functional Processes. Achieve major operational objective such as new product realization, asset management, production scheduling. Interpersonal Processes: These are the processes within and across small groups. Using electronic mail and conferencing. Defining Process Objects . There are 2 primary object types. a) Physical b) Informationl In Physical object processes real, tangible things are either created or manipulated. informational object processes create or manipulate information. Adding information to a physical object as it moves through a process is a common way of adding value. Using IT to improve physical processess allows greater flexibility and variety of outcomes, more precise control of process, reduction in throughtput time, and elimination of human labor. Defining Process Activities . There are 2 Activity types. a) Operational b) Managerial Operational activities involves basic business activities in the orgainisation. Mangerial activities includes control, plan or providing resources for operational processess. Capabilities of Information Technology for reshaping management issues includes . a) improve analytical accuracy b) enable broader management participation c) can generate feedbacks d) can streamline the time and resources a specific process consumes. To attain SCM integration, it is necessary to understand the infromation requirements of all the participants and design system that facilitate co-operation . Why BPR Project fails 1) Lack of sustained management commitment and leadership. 2) Unrealistic scopes and expectations. 3) Resistance to change. 4) Narrow technical approach. 5) Cost-Cutting focus. What can be done to make a BPR a Success 1) Do something smaller first ( Pilot Experiments ). 2) Conduct personal transformation ( change of mindset ). 3) Get IS and HR involved. 4) Empowered and collaborative workers support. 5) Realistic expectations. 6) Prioritise the objectives. SUCESS OF BPR DEPENDS ON THE PEOPLE WHO DO IT AND HOW WELL MOTIVATED ARE THEY. 7.2 System Modeling (Source. Yourdon system methods, model driven methods, 1993 ) Uses of Modelling Tools. 1) Focus on important system features. 2) Medium of communication with users. 3)Document the systems analysts understanding for the impementation for implementation by designers and programmers. There are 4 main types of modeling tools used inYSM ( Yourdon System Methods ) 1) Graphic 2) Tabular 3) Frame 4) Textual Graphic Tools . These are used to show high level components of particular aspect of a model. Each graphic modeling tools has set of icons used to represent specific model component. Graphic tools are preferred type of modeling tools when the connection between model components is important. Graphic tools in essential modeling are mainly of a semantic nature highlighting the meaning of the requirements. Graphic tools in implementation modeling are mainly concerned with syntax or structure. Tabular Tools . Some information is usefully laid out in tabular forms. Tabular tools may be useful in some circumstances particularly if subject matter expert finds the graphic modeling tool difficult to relate to. Frames . Frame is used informally for a certain type of specification tool. Frame specifications are used to specify all relevant info about a model component that has been declared on a diagram or another frame. Textual Tools . Textual grammar is defined formally, using meta language or set theory. 7.2a Entity Relationship Diagram (ERD) . ERD is semantic modeling tool used to identify and organize information and to model particular roles of importance to the enterprise and relationships between them. This may also be used as a tool for discovery of rules and events. These are not contingent on the modelers point of view or interpretation as these are real world facts. Enterprise Essential Model uses ERD to define entities it uses and the relationships between them. System essential modes uses ERD to show the entities and relationships that the system has responsibility for collecting or using information about. Components of ERD. Entity . Entity is a class of real world thing whose role of interaction with the enterprise is well-defined. Each entity has a unique name which should reflect the role that is played by that type of object. These things may be physical objects abstract concepts. Each entity must be distinct from but fulfill the same role as other occurrence of the entity. Instructor in ERD defines entity. Relationship . relationship represent possible associations that may occur between occurrence of entities. On diagram, each relationship is shown linked by lines to entities to which it refers. Occurrence of the relationship represents a single instance of the association between entities. Relationship Frame . Each relationship frame that includes the entities involved and other text forming a complete sentence. fonte. Yourdon system methods, model driven methods, 1993. Each occurrence of relationship corresponds to a specific occurrence of a Course and a specific occurrence of Topic. Binary Relationship . A relationship that refers to two entity occurrences is called binary relationship. Higher order Relationship . A relationship involving more than 2 entity occurrences is referred to as higher order relationship. fonte. Yourdon system methods, model driven methods, 1993. When entity is repeated in relationship, the relationship is referred to as being recursive. For recursive relationships, the role for the entities must distinguished as it can be seen in the frame that employee reports to other employee who is manager. fonte. Yourdon system methods, model driven methods, 1993. If the occurrence of entities in a recursive frame is not significant the relationship is known as symmetric. The relationship is friend of is an example of symmetric relationship. For symmetric relationships. the role for the entities doesnt have to be distinguished. fonte. Yourdon system methods, model driven methods, 1993. Associative Entity . This is the entity which acts as entity and relationship both. As a relationship it indicates a group of real world associations between entities. Attributes of associative entity do not describe the entities that participate in relationship but the occurrence of relationship between them. fonte. Yourdon system methods, model driven methods, 1993. a - describes a relationship. b - date on which marriage took place is neither an attribute of man nor woman but it describe the occurrence of relationship. marriage - associative entity date-as an attribute. Each occurrence of marriage records the fact that specific man was married to a specific woman on a specific date. Subtype, Subtyping and Supertyping . Subtype. Subtype of entity is a well defined group of occurrences of entity that may be regarded as entity in its own right. Subtyping indicates that the enterprise regards the entity as being made up of number of distinct identifiable groups each of which is referred to as a subtype. Supertype. supertype is regarded as a general grouping of several entities. fonte. Yourdon system methods, model driven methods, 1993. 7.2b State Transition Diagram ( STD ) STD models time dependent behavior. In STD, each state represents a period of time during which the system exhibits some observable behavior. fonte. Yourdon system methods, model driven methods, 1993. Components of STDs Access : Access on STD shows the possible access to the occurrence of entity when change of state occurs. Create Access : causes a new occurrence of entity to exist. occurs for initial transition. Read Access : for an event which occurs and requires some attributes to be used but not necessarily changed. Update Access : used where some of attributes of entity are to be changed. Delete Access : after this entity do not exists. Match Access : to check whether a specific occurrence of the entity exists. Connector : Where it is difficult to draw diagrams without crossing transaction lines a pair of connector symbols may be used. On diagram connector opis used in this way. Entity : each STD is for one state variable of specific entity. Example shown is for associative entity scheduled course. An entity may have several STD one for each of its state variable. Entity death. this indicates that occurrence of entity no longer exists and cannot be accessed. Event . event is the thing which causes transition to take place. When this event occurs a change of state may occur for one occurrence of the entity but it doesnt always occur. The responsibility whether or not it does occur resides in a data process. Initial State . state of the occurrence of entity when it is created. A transition to this initial state is referred to as an initial transition and must always include create. State . Each occurrence of the entity have a well defined state for a given state variable. Each schedule course may have a status of open, running, full or finished. 7.2c CONTEXT DIAGRAMS This is a diagram where systems is represented as a system diagram in whole. Purpose of context diagram is to depict how the system is connected to, interacts with other entities which makes its ( data ) environment. fonte. Yourdon system methods, model driven methods, 1993. Context diagram show all external entities which interact with the system and all data flows between these and the system. Components of Context Diagrams: Access Flow . access flow indicates that the system uses stored data which is shared between it and its environment. Continuous access flow. if system or a terminator continually updates or monitors the value in a store it is shown as continuous access flow. Discrete access flow. Access toa store that takes place at a particular instant of time. Data is present in store and can be accessed anytime. Context Process . This is a process group which represent the system. On context diagram system is regarded as a Black Box. All requirements for behavior or data storage by the system is considered to be within this process. Dataflow . data flow on context diagram either represents information produced within or outside the system which is used by outside world or by the system itself. Continuous data flow. continuous data flow represents a value that is available over a period of time. Discrete data flow. data flow that is only present for a instant of a time. Dialogue data flow. a data flow generated by the terminator for the use of system is combined with a data flow created by the system for use of terminator. Event Flow . indicates synchronization between the system and its environment. Continuous event flow. represents a status that is indicated over a period of time. Discrete event flow. event flow that is only present for an instant of time. Dialogue event flow. pair of event flows that occur at the same time may be combined and shown as a dialogue event flow. provided that they are tofrom the same terminator. Dialogue event flow is used to show a group of input flows, together with corresponding response flows either initiated by terminator or the system. Terminator . terminator is a producer or user of data that interfaces with the system. Data Store . a data store on the context diagram shows an interfaces between system and its environment. The store indicates that the system and terminator are decoupled in the sense that one can change values in the store independently of the other. 7.2d DATA FLOW DIAGRAMS (DFD) : A data flow diagram is the most important technique for modeling high level detail of the process within a system. These highlights the functions of the system and how they use stored information and transfer information between each other. fonte. Yourdon system methods, model driven methods, 1993. They show how input data is transformed to outputs results through sequence of functional transformations. Components of DFDs. Access Flow . access flow is used to show that a process needs to use or change stored information to accomplish its purpose. An access flow from a store show that the process uses information held in the store. This may correspond to:- Match Access. The process checks whether an entity or relationship occurrence matching a particular criterion exists. Read Access. The process uses the values of one ( or more) attributes for a selected occurrence of the entity. Check Access. The value of a state variable needs to be checked. An access flow going to a store shows that the process will alter information held in the store, This may correspond to a :-a) Create access. to create a new occurrence of an entity or relationship. b) Delete access. to delete one ( or more) occurrence of an entity or relationship. c) Update access. to modify the value of an attribute. d) Change access. to change the state of a state variable. Continuous Access Flow . In some situations it is necessary to continuously monitor the value in the store. This is carried out using data process. Link between this data process and the store is shown as continuous access flow. Control Process . Control process coordinate the activation of processes and signal to other components of system essential model. The coordination is carried out by interpreting and generating event flows and controlling processes by triggering or enabling or disabling them. In figure control process control car oxidation shows that control logic must be present to coordinate the monitoring, changing and replacing of solutions. It also derives the movement of the car body by interpreting the state of the oxidation bath and generating required signals such as move car signal to move the car body. Continuous event flow . continuous event flow is one that is available over a period of time, such as the status of a device. Continuous event flows represent a situation or status that is either true or not. Data Flow . a data flow represents the information generated by a source and used by another system function or terminator. On a data flow diagram the source of the data flow may be. a data process. the function represented by the data process is the one that generates the information. a process group. the function that generates the information within this group. Continuous Data Flow. Data Flow that persists over a period of time is called as continuous data flow. The value is present over a period of time and may change during that time. The figure shows a continuous data flow solution strength used by the process monitor solution strength. Solution strength is the present strength of solution which is continuously present. Dialogue data flow. dialogue data flow contains several data flows as an interface. At lowest level there can be two data flows in direct relation to each other, one causes the other to occur. Comment . free-format comments may be added to the DFD to elucidate or stress any important points. Comments may be used to highlight any aliases, ties to previous or anticipated implementation. Data flow diagram name ( DFD Name ) A data flow diagram has the same name as the corresponding process group show on the parent DFD. The context diagram is treated as a DFD with one process group. Data flow diagram number ( DFD Number ) A data flow diagram has the same number as the process group it describes in more detail. The child diagram of the context diagram is numbered 0. Data Process . A data process is a process that solely transforms data. Data processes may be continuous or descrete. A continuous data process may generate continuous or discrete event flows. A discrete data process cannot generate continuous event flows. Data Store . Stores act as buffers between processes that are active at different times. A data store holds the data at rest. A data store between two processes decouples them a data flow between them synchronizes them. In the figure the data store solutions is a collection of entity occurrence of all possible solutions used in the bathing of car bodies. Dialogue event flow . Dialogue event flow is a packing of several event flows between two processes or between a process and a terminator. Discrete access flow . A discrete access flow is an access to a store that takes place under the control of the system at a particular instant of time. In figure the process Check solution is correct accesses the store solution in tank to insure that the solution is correct for the car that is about to be bathed. Discrete data flow . data flow that is variable for an instant of time is discrete data flow. A discrete data flow is transient and must be processed at the moment it occurs. In the figure solution change, generated by change to new solution represents the need to tell the operators that they must change to a certain solution. This is an example of discrete data flow. Discrete event flow . event flow available for an instant of time is called as discrete event flow. If a control process detecting the discrete flow is not active at the time it occurs, the event flow will be lost. Enable Disable . This represents a process being enabled and disabled from a control process. An ED represents the fact that the control process enables the process at one time and disables it subsequently. A process that is enabled will run whenever its stimulus occurs or run continuously until disabled. Event Flow . An event flow represents the occurrence of an event ( discrete ). or the state of something ( Continuous ). Event store . An event store is a mechanism for storing events relating to resources until they can be used by a control process. When an event detector signals an event store ( rather than use a discrete event flow), it can respond, or until the store is reinitialized. Process . A process is a system function. It is either a data process. a control process. or a process group. It may be either continuous or discrete. Process group . A process group represents a group of processes as a single icon on the diagram. This group may also contains internal stores and flows to accomplish its purpose - these are hidden within the process group. Process group are used to reduce the complexity of any one data flow diagram by combining related functions and naming the combinations for the general function that this group carries out. In the figure change to new solution is a process group comprising processes control solution change, determine new solution, detect empty tank, etc. A process group is drawn on the diagram as a solid circle, it cannot be visually distinguished from a data process without looking at its specification. Trigger . A prompt labeled T represents a trigger. The trigger will activate a discrete process. which will then run to completion and stop. In figure check solution is correct is triggered. as it will run in zero time and immediately reply with one of the two event flows correct solution or incorrect solution. Strengths and Weaknesses of DFDs Strengths . DFD method is an object oriented method that allows to design systems using objects. It is widely used and promotes easy architecture and coding of a project. This method is also easy to learn. The symbols are few and simple and easy to translate. Weaknesses . There arent many weaknesses associated with this method. The DFD for large programs can be hard to translate and take a lot of time. Also, once the DFD is drawn for such a program, it becomes difficult to read and understand what is going on. The data flow can become confusing to the programmer in such an instance. Also, if the DFD is not drawn with the great amount of detail, then it is not useful to the programmer. Another disadvantage of using the DFD model is that the symbols used are not common to all DFDs. Different models use different symbols for the structure of a DFD. 7.2e DATA DICTIONARY (ref :1. E. Yourdon (1989). Modern Structured Analysis, Prentice-Hall. 2. T. De Marco (1991). Introduction to System Analysis and Design. IInd edition, Prentice-Hall ) During the analysis and design of a system, huge amount of data is collected. If data is going to be referenced throughout the design, and several people are responsible for that design notation, then individuals who may not have initialized that data but will need to reference it need to know where it came from. Manually thumbing through several volumes of the data is not the most efficient way to find such information. To make sure that everyone can access it, it needs to be stored centrally in one document. A Data Dictionary fulfills that role. Dictionary is basically a way of organizing the information, which is collected. This information enables us to work out the composition of the data, uniqueness and consistency of names and definitions of terms, and document them in dictionary which all team members can use. Ultimately it contain all information that enters, leaves and is transformed by the system, the policies surrounding that information, and description of all other objects and events of interest. This includes: data composition policies about data object and attribute descriptions event and state descriptions entity descriptions and relationship descriptions process descriptions System aspects discovered during analysis may be lost unless they are not documented in dictionary, but if everything is documented in dictionary there are all chances that dictionary is huge and contains lots of data about data.2 good ways for proper management are. Strict discipline: there should be a shared understanding between project members about what needs to be documented and how, who maintains and updates what-and severe penalties for anyone not sticking to it. Computerize it: with a project of any size, the data volume contained in the dictionary becomes too big to be handled by manual methods so it must be computerized to make the access quicker. Concepts of notationNotation helps to denote the basic kind of relationships betweenamong data items and elements, plus other information. These are some examples of data dictionary notation. 1) entity 1 entity A element B element C ( element D ) here it is shown that an entity A is made up of element B and element C and may or maynot contain element D. 2) entity 1 travel claim approval form 2 it shows that travel claim contains 2 elements, approval form and set of expense receipts. entity 2 expense receipts travel receipt expense receipts consists of travel receipt and additionaly it could also consist of number of incidental expendature. entity 3 travel receipt coach receipt air receipt rail receipt receipts not needed for a car travel travel receipt is needed for any form of travel undertaken with one exception that receipt is not needed if journey is done by car. entity 4 approval form name ref. no. claim total approval form has three parts, name of the person making the claim, the reference under which claim is made up and total being claimed. entity 5 ref. no. B123 reference number has a discrete value, the claim needs to be referenced as B123. entity 6 name 2 a name must be 2 character long entity 7 claim 1 .2 2 Claim figure must be made up of 1 or more numbers, a decimal point, and another 2 numbers to indicate fractions. Problems with building and maintaining Data Dictionary If the data dictionaries are poorly maintained, even on a fair sized project problems can arise. Aliases, imposters, hybrids, and real-time or orphaned data cause some of problems. Aliases: same definition given to several items with different names. Giving a common name so that we have a single word defining them all can solve this problem. Imposters: items having the same name but multipledifferent definitions. Giving a different (logical)name or new name can solve this problem. Hybrid data: when definition has a hidden or mixed use. Using meaningful names and do the things right away without thinking of changing in future can avoid this very crucial problem. Orphaned data: when nobody owns data, and nobody knows who created them. Author, data of entry and other pedigree information should be recorded. Ci sono. therefore, a number of ways in which the data dictionary will be impacted when designing the system. Definitions need to be put through a filtering process in order to make sure that rogue definitions do not go undetected. Regular analysis of data definitions is a time consuming but important and necessary exercise. Home An increase in company size results in an increase in information collection, processing and distribution. Hence it becomes necessary to handle many customer accounts and production records with many more interrelationships. In addition to increased information records, information needs and associated difficulties there arises the problem of delegation of authority and responsibilities. Basic Information System The basic functions of the company such as production, sales, finance and management functions will not change. However the introduction of an MIS will facilitate fantastic improvement in the information communications network. The objective of developing or improving a management information system can be stated as below: To provide the type of information environment that will integrate the basic operating functions and To provide management with access to information relative to complex activities in decentralized organizations. Also, as the company grows and becomes more complex much of the basic functions and information needs remain the same. Some of these internal information needs are shown as below:1. Accounting Control 2. Plans and budgets 3. Payroll by hourly and salaried groups 4. Inventory of materials, in-process and finished goods 5. Sales by product, salesman. customer and Area 6. Purchasing records, vendors, commitments 7. Distribution-Transportation and warehousing 8. Production by product, customer, cost, overruns and backlog 9. Engineering-new products, schedules, equipment, costs 10. RampD etc. etc. Although the current trend is to develop IS (with computer applications) in the areas other than the traditional areas, the bulk of information systems lie in the following categories. Over time, a typical manufacturing company has developed the major information systems shown above. These systems are not separate and distinct they connect interact and otherwise tie the subsystems of the organization together through the medium of information. 9.1 Financial Information System The financial system is probably the most important single management information system, in the company, and in most companies it is the oldest and the best developed. These systems basically deal with large amounts of data and involve planning in the financial sector. However the budgeting function performed is wholly futuristic. Periodically the management approves a financial plan (the master budget) that assigns responsibility for maintaining incomes, investments and costs within standard limits. These plans are the basis for periodic financial reports and these reports are used by the system for exercising control and for futuristic planning. The major operating systems of a company along with their respective functions (Shown in figure above) merge or integrate with the Accounting and Financial Information System to facilitate financial reporting and for management information for planning and control. Moreover, the financial system has a very significant impact on other systems when one considers that the ultimate common denominator of many operating decisions is the dollar. Perhaps, Billing (Invoice Preparation) is the most widely used data processing application among financial information systems. 9.2 ProductionOperation System Model From an operating standpoint, such a system is undoubtedly the most important in a manufacturing company. It crosses all subsystem boundaries and has an effect throughout the company. The production Operations system is concerned with information about the physical flow of goods or the production of goods and services. It covers such activities as production planning and control, inventory control and management, purchasing, distribution and transportation. Because the quantities of data are so large and the timing of information so essential, the productionoperations system is the most adaptable to automation and yields the largest benefits in terms of immediate solution of critical and costly problems. Although other applications (eg. decision-making, total system simulation) may offer greater potential, this functional area usually offers immediate pay-offs. Sales Analysis Engineering Inventory Control and Production Scheduling ProductionOperations Facilities Purchasing Financial Sales and Distribution Integration of subsystems through the information flow in the productionOperations System (Adapted from. Information systems for modern management by Murdick, Ross, Claggett)9.3 Marketing Management Information System The basic areas of the marketing function that lend themselves to improvement through information systems include: (1) ForecastingSales planning (2) Market research (3) Advertising (4) Operating and control information. Examples include sales reports and distribution cost reports. A marketing systems should also take into account of the necessity elsewhere in the organization concerning for information concerning market sales, and other internal information that affects decisions in other subsystems of the company. Three types of marketing systems may be summarized as 1. Control systems 2. Planning systems and 3. Market research systems. Customer invoices Sales Profitability Marketing budgets by product by product Sales call reports product line product line Cost reports customer class customer Inventory reports cost center salesman Accounts receivable region Accounts payable salesman Annual Reports (customers, suppliers etc.) Analyses done by the system for periodic automated reporting. -- Life cycle analysis -- Marketing Personnel Analysis Also OUTPUTS of the system include (Adapted from. Information systems for modern management by Murdick, Ross, Claggett) CHAPTER 10 STRATEGIES FOR IS (JMJ) The face of business is changing. Businesses that do not become an e-business will not be around in five years. After watching the Superbowl this year, one might be will to accept these statements at face value. These statements lend themselves into being the mottoes of Silicon Valley, knowing these quotes come from Andy Grove chairman on Intel and also from a recent article in the Harvard Business Review by Hamel. It should obvious that an industry representative would make claims on the future that are much more hype than reality, but when these same statements are made in prestigious business journals, how does the business world react Information Systems are the medium of this evolution in business and the proliferation of technologies is the catalyst IS change. The major shift coming is the impact of the internet-platform for doing business, which is currently being done on proprietary EDI systems. It is believed by businesses on the cutting edge of technology that the internet will be a leveling field for businesses that could not afford EDI in the past. EDI also was once claimed to be an evolutionary business step, but at an average cost of 50 million dollars for the system and in many cases no return on the investment. the future of EDI looks very grim, so say some of the successful practitioners of EDI. In a recent joint study by the Economic Research Council and Oasig concluded that between eighty and ninety percent of EDI systems do not meet original performance goals. So while EDI is in its decline, is it prudent to embrace the new technologies of e-business Forecasts call for a growth of e-business from 43 billion in 1998 to 1.3 trillion in 2002. The world has been wrapped many times over with internet connection lines and business already make up ninety percent of internet traffic. There is little doubt that the internet is here to stay and it will have an impact on business, especially in the areas of information systems. If IS were about technology alone, its future would the very bright. Yet, information systems are more about the data and the people that use them to resolve problems. The technology is only a tool and not the answer to IS. Many software companies that do IS consulting and IS teams within the company may not agree with that philosophy, but software vendors have a tendency to be inflexible with their platforms and IS departments have a history of being rouge divisions within company structure. A strategy to look at the future of IS, really needs to examine the past, and take a sober look at how IS in its many forms have fallen short of its promises. Steve Cardell and Neil Tiffin in an article in Industrial Management compiled six rules for putting together information systems. 1. Do not re-engineer and implement systems concurrently. From there studies the success rate is less than five percent. 2. Recognize that people fix things and information technology does not. They site Henry Ford as an example, his plants were able to process steel from iron ore to finished product in three days, in which he kept a few days inventory. 3. The business, not the IS department owns the system. This keeps costs under control and implementation on track. 4. Have an effective decision making forum. Managers and department heads are already busy, incorporating a new system that changes policy can be made very difficult if they are not kept up on what changes are taking place. 5. Configure only what the business needs. 6. When given a choice, choose flexibility In reality strategies for IS come from studying data-flow with in an organization, and clearly defining the goals for the system and the users. If consultants are hired in they need to configure the system to fit the data flow of the business. Many EDIERP software companies had businesses reshape their data-flow, resulting in suboptimal returns. The new frontier of the internet and the information technology that drives it along with the heavy performances of high-tech industry market can be intoxicating to businesses, especially those IS illiterate. From the UH panel discussions, it becomes obvious EDI has work in only a few cases, there is no standard of IS software for the internet, everyone knows they must move to the internet, some of the companies invited to the panels do not have clear goals of how their organization should work with IS, and not one company was a the same level information technology if this is the picture of the real world, the opening statements quoted are very risky, either very naiumlve or very arrogant. Quietly below the surface-hype of technology lies the ultimate future of IS, in the areas of data flow analysis. This is the one common thread for all the business that have succeed with any IS system no matter the decade it occurred in. CHAPTER 11 E-Commerce and EDI 11.1 ELECTRONIC COMMERCE (TM) Electronic commerce may be defined as the entire set of processes that support commercial activities on a network and involve information analysis. These activities spawn product information and display events, services, providers, consumers advertisers, support for transactions, brokering systems for a variety of services and actions (e. g. Finding certain products, finding cheaply priced products etc.), security of transactions, user authentication. etc. Ref. N. R Adam and Y. Yesha. Electronic commerce: an Overview There have been several similar electronic technologies in the past, for example Electronic data interchange (EDI) and Electronic funds tranfer (EFT) have been around for more than 20 years now. While many of these have electronic trading technologies have had radical effects within their own markets and created their fair share of publicity, none have attracted the level of hype or have been hailed as purveyors of economic transformation to the extent that e-commerce has in recent years. Ref. The Economist The Economist Electronic commerce survey :In search of the perfect market For example, EDI never gained the ubiquitous acceptance that was initially anticipated for it. High costs for initial investment, maintenance costs, or simply lack of preference by potential users kept EDI technologies from developing at a more rapid pace and has traditionally restricted its use to very large corporations. Electronic commerce has experienced an explosion due to the convergence of these technology developments, the merging of the telecommunications and computing industries, and the business climate. Ref. C Beam and A Segev The rise of Electronic commerce :Contributions from three factors A ubiquitous digital infrastructure that provides an efficient means for communication and information sharing presents an extremely attractive new medium for electronic commerce and for the first time has the potential to deliver what the notion of EC has always implied. D. Tapscott. The Digital Economy: Promise and peril in the age of networked intelligence Electronic commerce involves issues (both technical and non technical) that are multi - disciplinary in nature. They are complex in nature and overlap significantly with each other. Technical research issues overlap with other technical research areas. For example, finding and filtering information is a fundamental requirement of an electronic commerce system but can be an equally important service for a digital library. The figure below depicts the multidisciplinary nature of EC. As shown in the fig. The model is made up of several major components, beginning with the consumer who is interested in purchasing some goods electronically from some vendors whose product lines are represented in and are part of a global electronic marketplace. The objectives of E-Commerce are several. Primarily they involve increasing the speed and efficiency of business transactions and processes, and improving customer service. Also EC should. - Streamline procurement processes thereby cutting overall costs via a more competitive process - Contribute to a decrease in the length of production cycles. - Enable enterprises to conduct business with distant partners the same way they do with neighboring partners. - Empower small businesses. - Create new services and businesses. - Help expand the horizon of participants. In contrast to the emerging area of EC, EDI (Electronic data interchange) which has been around (in the same form) for 20 years now is the cause of positive and negative effects on industrial structures. A true cost benefit analysis of the effects can be difficult to assess, however the costs become much easier to quantify than the benefits. Reduced personnel expense for data entry, paper and postage savings, and shortened receivable cycles are all quantifiable benefits, but the thousands to hundreds of thousands of dollars required to set up and maintain the implementation of traditional EDI needs to be justified with more significant benefits than these. For an EDI implementation to be successful, it needs to be the direct cause of improved productivity and internal operations, create closer customer vendor relations, provide a competitive advantage in the marketplace, and open up the procurement process. Historically this has not been the case for two reasons :The high cost involved with EDI, especially for small to medium-sized enterprises(SMEs), and what we refer to as standard issues. (Ref. Electronic commerce Nabil Adam, Oktay Dogramaci et al.) E-C applications in Supply-Chain and manufacturing Another area where EC applications facilitate improvement is supply chain management. The objective of an electronic commerce strategy is to provide purchasing managers with better control over their companies purchasing habits and relationships with suppliers Continuous improvement of an organizations supply-chain is directly related to its performance, and EC applications are being used in procurement processes more and more frequently to this end. Changes in the supply chain are closely related to inter-business retail processes. The advantages of EC in supply-chain management include access to a wide range of suppliers and effective use of organizational resources that are essential for implementing just-in-time (JIT) manufacturing systems..Ref. C Curtis Getting on to the e-Commerce supply chain Just in time Internet week Sept. 1997 These automated systems provide new types of information for businesses that implement them. Among the enhanced capabilities for managers are improved sales forecasts, more accurate balance sheets, and closer relationships with customers using a new interface. Direct communications between suppliers and customers streamlines the supply chain and delivers new relevant information to manufacturers in real-time. For one example of how businesses are accomplishing these goals, craig (in internet Week Nov. 1997) describes a joint venture between SAP and Digital Equipment Co. to keep vending machines filled to demand with a web-based EDI system. An embedded computer in the vending machines is connected to the internet, and each time a product is purchased a message is sent to the supplier. This gives suppliers crucial information about their distribution channels in real-time, and removes the requirement for vending machine operators to use non standard proprietary software that accomplished this task in the past. 11.2 ELECTRONIC DATA INTERCHANGE (EDI) (MR) (Source. EDI ebook, at editraining) Electronic Data Interchange or EDI is the electronic exchange of business documents from one companys computer to anothers computer in nationally standard structured data formats. Using EDI to exchange business documents eliminates the rekeying of the data, resulting in more accurate data. In EDI, data necessary for conducting business is transmitted directly into a system without human intervention. We can transmit and receive EDI documents with companies such as banks, railroads, customers and suppliers. The companies who send and receive EDI with are referred to as trading partners. For many years business data has been exchanged electronically on tapes, disks. diskettes and over direct computer to computer hookups. Companies realized replacing the paper used in business transactions with electronic communication saved both money and time Customers and suppliers were interested in sending and receiving electronic documents however, each company had different documents need and different computer and communication medium. The effort to maintain different document formats and different communications hookups became time consuming and costly. Electronic transactions started becoming standardize. Different standards for different industries still exist. The Accredited Standards Committee (ASC) X12 of the ANSI was created to support the national standards of EDI. Transaction sets (standard business transaction formats) are developed and maintained by the ASC X12. Most of Industries use subset of the X12 standards. Following are some major industries that use subsets. AFPA Paper Industry CIDX Chemical Industry WINS Warehouse Industry VICS Retail Industry UNEDIFACT Standards are used internationally. EDI Data Structure Individual electronic transmission between trading partners is grouped in an electronic envelope similar to putting paper documents into paper envelopes. The electronic envelope specifies who is sending and who is receiving the documents. Within each electronic envelope is a collection of documents of the same type, this is called a functional group. An example of the functional group is a collection of invoices. You can group several invoices together and send them in a functional group in EDI. Documents (purchase orders, invoices..) are referred to as transaction sets in ANSI X 12 standards and messages in UNEDIFACT standards. There are hundreds of document types defined by EDI standards. A document contains segments that are logical groups of information. Each segment is preceded by a segment identifier and terminated by a segment separator. A segment is made up of data elements. This is where the information is stored . How Does EDI Work EDI involves three functions within each computer system: 1) Application Interface System. 2) EDI Software 3) Communications Handler Application Interface System Processes the data to be sent to, or received from, the trading partner. Moves electronic transactions to or from the application system. Programs separate and deliver inbound transactions to the application systems. 4. Delivers inbound transactions to the applications systems and gathers transactions from the application systems for outbound transmission. EDI Software 1. Manipulates and routes data between the application system and the communications handler. 2. Translates Business documents into and out of the X12 formats. 3. Creates Functional Acknowledgments (EDI transaction that notifies the trading partner that an electronic document was received). 4. Verifies the identity of trading partners. 5. Validates the transactions by checking a master file against the information transmitted. Communications Handler Transmits data to and from the trading partner through a value-added network. Protects against transmission errors or interruptions. Example of EDI Process: This example shows the process of a shipment notice from the manufacturer to the customer. These are various steps involved in process: 1. The data is extracted from the shipment and database. 2. The data is translated by the EDI software into a standard X12 EDI shipment notice format. 3. The EDI shipment notice is transmitted through a Value Added Network (VAN) to the company. 4. The company receives the EDI shipment notice. 5. The EDI shipment notice is translated into a format that can be used to update the database of the company. (Source. Article by G. Berton Latamore, Apics, February 1999,No.2) Although EDI has been the traditional approach to automating business transactions between trading partners, e-commerce, using Java applets embedded in Internet-enabled applications, is coming on strong. E-commerce offers several advantages over EDI. The initial investment in technology is much less. For smaller companies with lower trading volumes, the internet costs much less than a VAN. Internet reaches everyone in the supply chain, supports near real-time messaging, and supports both machine-to-machine and human-to-machine transactions. EDI has advantages for larger manufacturers that must automate complex transactions among a large community of suppliers. It provides a standard way to format key transaction data and provides a complete set of messages, including acknowledgements. EDI also includes built-in security . while the Internet is still a very insecure environment. E-commerce sites focused on the supply chain have been designed to extend electronic commerce to supply chain members that have not invested in EDI, rather than replacing existing EDI sites. Most experts expect this pattern to continue and advise manufacturers with EDI systems to consider adding e-commerce front ends to allow smaller suppliers or customers to communicate directly with their existing infrastructure. However, experts caution that EDI and e-commerce are not necessarily antagonistic and agree most companies need a combination both to effectively reach their entire supply chain. Where EDI Excels Less expensive and easier to implement for simple transactions bteween two trading partners. However becomes expensive and complex when trying to support sets of complex transactions among large groups of trading partners. Provides a complete, integrated package to support transactions . including receipts showing that transactions were received e-commerce only provides a template from which each form must be created and each response programmed Supports near real-time transactions. Handles a much wider range of transaction types and can be used for any kind of transaction between trading partners. Provides a complete security package e-commerce has no built-in security and requires that a suite of separate security applications be custom integrated. Supports both machine-to-machine and man-to-machine transactions EDI only does machine-to-machine, making it an impractical answer for handling specialty or occasional orders. VANs are very secure the Internet, by design, is insecure . Reaches everyone over the Internet EDI only reaches trading partners who can afford connectivity to the VAN of choice. Optimized for large volumes of transactions processed on large servers or mainframes e-commerce is most successful in low-volume environments running on PCs or smaller servers. 12.3 Distribution and Transportation System ACQUISITION COSTS: these costs include the price of the items, the shopping time, the paper work, expediting (emergency buy, down time), mistakes (returns, rejects, quantity errors this will generate expediting costs), and the price for internal handling (receiving and storing). BREAK-BULK CARGO: Cargo, which is, shipped a unit (i. e. Palletized cargo, boxed Cargo, large machinery, trucks and pre-slung cargo). BULK CARGO: Loose cargo that is loaded directly into a ships hold. BULK CARRIER: There are two types of bulk carrier, the dry-bulk carrier and the liquid-bulk carrier better known as a tanker. Bulk cargo is a shipment such as oil, grain, or ore which is not packaged, bundled, bottled, or otherwise packed and is loaded without counting or marking. BUSINESS PROCESS (BP) : A set of logically related tasks performed to achieve a defined business outcome. CARRIER(S) CONTAINER(S)SHIPPER(S) CONTAINER(S): The term Carrier(s) Container(s) or Shipper(s) Container(s) means containers over which the carrier or the shipper has control either by ownership or by the acquisition thereof under lease or rental from container companies or container suppliers or from similar sources. Carriers are prohibited from purchasing, leasing or renting shipper owned containers. CHANGE ANALYSIS: Study of suitable changes of the activities of an enterprise in concrete situation CORRUGATED CASES: Built like a sandwich cardboard - characteristic arches of wavy fluting lying between two pieces of smooth board on the outside. CONTAINER: The term container means a single rigid, non-disposable dry cargo, insulated, temperature controlled flatrack, vehicle rack portable liquid tank, or open top container without wheels or bogies attached, having not less than 350 cubic feet capacity, having a closure or permanently hinged door that allows ready access to the cargo (closure or permanently hinged door not applicable to flatrack vehicle rack or portable liquid tank). CONTAINER SHIP: Ocean going ship designed to carry containers both internally and on deck. Some are self-sustaining. CONTAINERIZATION: Concept for the ultimate unitizing of cargo used by both steamship lines and air cargo lines. Containers allow a greater amount of cargo protection from weather, damage, and theft. DATA: Raw information representing events occurring in the organization before they are organized into an understandable and useful form for humans DATA DICTIONARY: A way of organizing information, which is collected. This information enables one to work out the composition of the data, uniqueness and consistency of names and definitions of terms, and document them in dictionary which all team members can use DATA FLOW: Data flow on context diagram either represents information produced within or outside the system which is used by outside world or by the system itself DATA FLOW DIAGRAM: An important technique for modeling high level detail in a process within a system. They highlight the functions of the system and how they use stored information and transfer information between each other. DATA-ORIENTED WORK: Refers to the development parts whose purpose is to design technical solutions to this specification. DISTRIBUTION CHANNELS: Methods by which distribution get products to market. EDI: Electronic Data Interchange Proprietary systems by which companies share information. END-USERS: Customers that are served by distribution. ENTITIES RELATIOINSHIP DIAGRAMS (ERD): A semantic modeling tool used to identify and organize information and to model particular roles of importance to the enterprise and relationships between them ENTITIES: A class of real world thing whose role of interaction with the enterprise is well defined. INFORMATION: A derivative from meaningful interpretation of data. INFORMATION SYSTEM: A set of interrelated components that collect (or retrieve), process, store and distribute information to support decision making and control in an organization. INFROMATION TECNOLOGY (IT) : This includes the capabilities offered by computers, Software and telecom. The current media by which information is transferred. HOLDING COSTS: are the interest costs, the storage cost, the control cost (shipping, transportation, security), taxes, insurance, and the shrinkage cost (shipped short or long, stolen, obsolescence). HUB: A central location to which traffic from many cities is directed and from which traffic is fed to other areas. MANAGEMENT INFORMATION SYSTEMS (MIS): A division in corporate structure that creates and maintains IS for the management levels of an organization. OFFICE AUTOMATION SYSTEMS (OAS): Serves the knowledge level of an organization. PALLET: Load carrying platform to which loose cargo is secured before placing aboard the aircraft. PERISHABLES: Any cargo that loses considerable value if it is delayed in transportation (Usually refers to fresh fruit and vegetables). PROBLEM-ORIENTED WORK: In information systems development, refers to the development parts whose purpose is to specify what the information systems will do. STRADIS (Structured Analysis And Design of Information Systems): follows the Top-down approach (functional decomposition) for analyzing processes. TOTAL PROCUREMENT COSTS: are the holding costs and the acquisition costs. TRANSACTION: A performance or management of a business. In the context of distribution, it is all the interactions between manufacturing, distribution and end-users. TRANSACTION PROCESSING SYSTEMS (TPS): Serves the operational level of an organization. UNITISATION: The packing of single or multiple consignments into ULDs or pallets. USER: One who would be accessing an IS interface in order to gain a knowledge, to apply to a decision making process.

No comments:

Post a Comment